HDAC1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | N term -peptide of human HDAC1 |
HDAC1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | N term -peptide of human HDAC1 |
Rabbit Polyclonal PPARGC1A Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Phospho-CREB1-S133 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S133 of human CREB1 |
Modifications | Phospho-specific |
Rabbit anti-TFAM Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TFAM |
Rabbit Polyclonal Anti-HDAC2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | HDAC2 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human HDAC2. |
Rabbit Polyclonal Anti-MALT1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | MALT1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human MALT1. |
PPARG Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | N term -peptide of human PPARG |
Phospho-CREB-Ser133 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Ser133 of human CREB |
Rabbit Polyclonal Anti-RCOR1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RCOR1 antibody: synthetic peptide directed towards the N terminal of human RCOR1. Synthetic peptide located within the following region: MVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASS |
Rabbit polyclonal HDAC2 Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HDAC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 410-439 amino acids from the Central region of human HDAC2. |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB around the phosphorylation site of Sersine 133. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-TBP antibody, Loading control
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
HDAC2 Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human HDAC2 |
Rabbit anti-TP53 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TP53 |
Rabbit Polyclonal HDAC2 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal anti-HDAC1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human HDAC1. |
Rabbit polyclonal anti-P300/CBP antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human P300/CBP. |
Rabbit polyclonal TFAM Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TFAM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 216-246 amino acids from the C-terminal region of human TFAM. |
Rabbit Polyclonal CREB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB. |
Rabbit polyclonal p53 (Ab-15) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of Serine 15. |
Rabbit polyclonal p53 (Phospho-Ser15) antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 15 (P-L-SP-Q-E). |
Modifications | Phospho-specific |
Rabbit Polyclonal antibody to POLR2B (polymerase (RNA) II (DNA directed) polypeptide B, 140kDa)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 172 of RNA polymerase IIB (Uniprot ID#P30876) |
Rabbit polyclonal CREB (Ser133) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CREB around the phosphorylation site of serine 133 (R-P-SP-Y-R). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-p300 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human p300. |
Rabbit polyclonal anti-HDAC-1 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Anti-HDAC-1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 466-482 of Human HDAC-1. |
Anti-HDAC2 (Phospho-Ser394) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 394 (E-D-S(p)-G-D) derived from Human HDAC2. |
Modifications | Phospho-specific |
Anti-HDAC2 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa. 392~396 (E-D-S-G-D) derived from Human HDAC2. |
Rabbit polyclonal Phospho-p53(T18) Antibody
Applications | Dot, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53. |
Modifications | Phospho-specific |
Rabbit polyclonal p53 Antibody (S315)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This p53 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 293-322 amino acids from human p53. |
Rabbit polyclonal p53 (Phospho-Thr387) antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of threonine 387 (F-K-TP-E-G). |
Modifications | Phospho-specific |
Rabbit Polyclonal anti-TP53 antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal Anti-HDAC2 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN |
Rabbit Polyclonal Anti-HDAC2 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN |
Goat Polyclonal Antibody against CREB3L4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PSGRIRSVLHADEM, from the C Terminus of the protein sequence according to NP_570968. |
Rabbit polyclonal antibody to POLR2G (polymerase (RNA) II (DNA directed) polypeptide G)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 122 of RNA polymerase IIG (Uniprot ID#P62487) |
Rabbit anti-HDAC2 (Phospho-Ser394) polyclonal antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanHDAC2 around the phosphorylation site of serine 394 (E-D-SP-G-D). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-TFAM antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TFAM. |
Rabbit polyclonal HDAC2 (Ab-394) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human HDAC2 around the phosphorylation site of Serine 394. |
Rabbit polyclonal CREB phospho S133 antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CREB phospho peptide corresponding to amino acid residues 122-147 of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Modifications | Phospho-specific |
Rabbit polyclonal Phospho-p53(S20) Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S20 of human p53. |
Modifications | Phospho-specific |
Rabbit Polyclonal p53 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human p53. |
Rabbit anti-SOD2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SOD2 |
Rabbit Polyclonal Anti-SIN3A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SIN3A antibody: synthetic peptide directed towards the N terminal of human SIN3A. Synthetic peptide located within the following region: KRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSA |
Phospho-CREB1-S142 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S142 of human CREB1 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RCOR1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RCOR1 Antibody: synthetic peptide directed towards the middle region of human RCOR1. Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS |
Rabbit Polyclonal Anti-NRF1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NRF1 Antibody is: synthetic peptide directed towards the middle region of Human NRF1. Synthetic peptide located within the following region: WATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSE |
Rabbit Polyclonal Anti-CREB3L2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CREB3L2 antibody: synthetic peptide directed towards the N terminal of human CREB3L2. Synthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF |
Rabbit Polyclonal Anti-TBPL1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TBPL1 antibody: synthetic peptide directed towards the middle region of human TBPL1. Synthetic peptide located within the following region: LQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPA |
Rabbit Polyclonal Anti-NRF1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NRF1 antibody: synthetic peptide directed towards the C terminal of human NRF1. Synthetic peptide located within the following region: IVLSGETAAAVGALTGVQDANGLFMADRAGRKWILTDKATGLVQIPVSMY |