Germany
Japan
United Kingdom
China
Antibodies
View as table Download
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal antibody to PDE6D (phosphodiesterase 6D, cGMP-specific, rod, delta)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 150 of PDE6D (Uniprot ID#O43924) |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%). |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Dog, Bovine, Bat, Hamster, Elephant, Panda, Horse, Rabbit (94%); Rat, Pig, Opossum (88%). |
ADAMTS1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%). |
Goat Polyclonal Anti-Rab27 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a and rab27b produced in E. coli. |
Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%). |
Goat Polyclonal Anti-Rab11 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mousse, Canine, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptides derived from within residues 110 aa to the C-terminus of mouse Rab11a, Rab11b and Rab11c (Rab25) produced in E. coli. |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
TRPV2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Horse, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Horse, Pig (100%); Gibbon, Bovine, Hamster, Panda, Rabbit (93%); Mouse, Dog (87%); Elephant (80%). |
FBL Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FBL |
Rabbit Polyclonal Anti-SRD5A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
Rabbit Polyclonal Anti-HSD17B11 Antibody
| Applications | IHC |
| Reactivities | Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD17B11 antibody: synthetic peptide directed towards the N terminal of human HSD17B11. Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
ADRB3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ADRB3 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human ADRB3. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Monkey (94%). |
Rabbit polyclonal anti-Gli-3 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Rabbit anti-S100A10 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human S100A10 |
Rabbit Polyclonal PCNA Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Goat Polyclonal Anti-Rab11 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mousse, Canine, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptides derived from within residues 110 aa to the C-terminus of mouse Rab11a, Rab11b and Rab11c (Rab25) produced in E. coli. |
Goat Polyclonal Anti-Rab27 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a and rab27b produced in E. coli. |
USD 425.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
Active filters
Reactivities
- Monkey
Applications
- IHC
Isotypes
- IgG
Clonalities
- Polyclonal
Filter by
Category
Target Symbol
- RAB27A (5)
- TP53 (4)
- ENPP3 (3)
- ENTPD2 (3)
- GLG1 (3)
- GPC4 (3)
- GPR4 (3)
- HSP90AB1 (3)
- OLFM4 (3)
- OXGR1 (3)
- RAB11A (3)
- SLC1A4 (3)
- ADAMTS1 (2)
- ADRA1B (2)
- BDKRB1 (2)
- BEST4 (2)
- CALCRL (2)
- CCKAR (2)
- CCR4 (2)
- CD70 (2)
- CNR2 (2)
- CTSD (2)
- DRD2 (2)
- DRD3 (2)
- FFAR4 (2)
- GPR65 (2)
- GRPR (2)
- HCAR1 (2)
- HCRTR1 (2)
- HSP90B1 (2)
- KCNJ6 (2)
- KCNMA1 (2)
- NR2E3 (2)
- PCNA (2)
- PTGES (2)
- PTH2R (2)
- SLC11A2 (2)
- SLC1A5 (2)
- SLC39A14 (2)
- SLC5A9 (2)
- STIP1 (2)
- SURF4 (2)
- TAS1R1 (2)
- TM9SF3 (2)
- TSPAN13 (2)
- UCHL1 (2)
- VIM (2)
- WNT10A (2)
- WNT4 (2)
- AAMP (1)
- AAPK1 (1)
- ACTN1 (1)
- ADGRL3 (1)
- ADRB2 (1)
- ADRB3 (1)
- AGTR2 (1)
- AIFM2 (1)
- AK1 (1)
- AKT2 (1)
- ALDOB (1)
- ANXA7 (1)
- ATP5PF (1)
- AVPR1B (1)
- BEST2 (1)
- BSG (1)
- CASP3 (1)
- CASP7 (1)
- CCL2 (1)
- CCNA1 (1)
- CCNB1 (1)
- CCR6 (1)
- CD247 (1)
- CD36 (1)
- CD38 (1)
- CHRM3 (1)
- CLGN (1)
- CNOT7 (1)
- COX7B2 (1)
- CTCF (1)
- CYP11B1 (1)
- CYP21A2 (1)
- DDX39A (1)
- DPP7 (1)
- DRD1 (1)
- DRD5 (1)
- EGLN1 (1)
- EIF2S1 (1)
- ENO1 (1)
- ERP44 (1)
- ESRRB (1)
- F7 (1)
- F9 (1)
- FAM3C (1)
- FBL (1)
- FOS (1)
- FPGT (1)
- FPR2 (1)
- FSCN1 (1)
- GALR1 (1)
- GANAB (1)
Antibody Hosts
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (207)
- Transmembrane (158)
- GPCR (63)
- Secreted Protein (23)
- ES Cell Differentiation/IPS (19)
- Transcription Factors (18)
- Stem cell - Pluripotency (16)
- Protease (13)
- Cancer stem cells (5)
- Ion Channels: Potassium (5)
- Nuclear Hormone Receptor (4)
- Ion Channels: Other (3)
- Protein Kinase (3)
- Stem cell relevant signaling - Wnt Signaling pathway (3)
- Adult stem cells (2)
- Induced pluripotent stem cells (2)
- Ion Channels: Transient receptor potential (2)
- P450 (2)
- Embryonic stem cells (1)
- Ion Channels: ATP Receptors (1)
- Phosphatase (1)
Pathways
- Neuroactive ligand-receptor interaction (45)
- Pathways in cancer (28)
- Metabolic pathways (25)
- Calcium signaling pathway (22)
- Basal cell carcinoma (16)
- Wnt signaling pathway (15)
- Hedgehog signaling pathway (13)
- Melanogenesis (13)
- Purine metabolism (13)
- Huntington's disease (10)
- Progesterone-mediated oocyte maturation (10)
- Prostate cancer (10)
- Cytokine-cytokine receptor interaction (9)
- Vascular smooth muscle contraction (9)
- Cell cycle (8)
- Chemokine signaling pathway (8)
- MAPK signaling pathway (8)
- Alzheimer's disease (7)
- Colorectal cancer (7)
- NOD-like receptor signaling pathway (7)
- Parkinson's disease (7)
- Endocytosis (6)
- Gap junction (6)
- Regulation of actin cytoskeleton (6)
- p53 signaling pathway (6)
- Apoptosis (5)
- Cell adhesion molecules (CAMs) (5)
- Chronic myeloid leukemia (5)
- Glycolysis / Gluconeogenesis (5)
- Hematopoietic cell lineage (5)
- Adherens junction (4)
- Amyotrophic lateral sclerosis (ALS) (4)
- Bladder cancer (4)
- Complement and coagulation cascades (4)
- Endometrial cancer (4)
- Glioma (4)
- Lysosome (4)
- Melanoma (4)
- Natural killer cell mediated cytotoxicity (4)
- Neurotrophin signaling pathway (4)
- Nicotinate and nicotinamide metabolism (4)
- Non-small cell lung cancer (4)
- Pancreatic cancer (4)
- Small cell lung cancer (4)
- T cell receptor signaling pathway (4)
- Thyroid cancer (4)
- Androgen and estrogen metabolism (3)
- Antigen processing and presentation (3)
- Arachidonic acid metabolism (3)
- C21-Steroid hormone metabolism (3)
- DNA replication (3)
- Fc epsilon RI signaling pathway (3)
- Fc gamma R-mediated phagocytosis (3)
- Focal adhesion (3)
- Mismatch repair (3)
- PPAR signaling pathway (3)
- Pantothenate and CoA biosynthesis (3)
- Riboflavin metabolism (3)
- Starch and sucrose metabolism (3)
- VEGF signaling pathway (3)
- Adipocytokine signaling pathway (2)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (2)
- B cell receptor signaling pathway (2)
- Base excision repair (2)
- Caffeine metabolism (2)
- Drug metabolism - other enzymes (2)
- ECM-receptor interaction (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- Fructose and mannose metabolism (2)
- GnRH signaling pathway (2)
- Insulin signaling pathway (2)
- Jak-STAT signaling pathway (2)
- Long-term depression (2)
- Nucleotide excision repair (2)
- Oocyte meiosis (2)
- Oxidative phosphorylation (2)
- Pathogenic Escherichia coli infection (2)
- Prion diseases (2)
- Pyruvate metabolism (2)
- Renal cell carcinoma (2)
- Ribosome (2)
- Taste transduction (2)
- Tight junction (2)
- Toll-like receptor signaling pathway (2)
- Type II diabetes mellitus (2)
- Acute myeloid leukemia (1)
- Allograft rejection (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Asthma (1)
- Autoimmune thyroid disease (1)
- Axon guidance (1)
- Basal transcription factors (1)
- Cardiac muscle contraction (1)
- Citrate cycle (TCA cycle) (1)
- Dilated cardiomyopathy (1)
- Dorso-ventral axis formation (1)
- Drug metabolism - cytochrome P450 (1)
- ErbB signaling pathway (1)
- Ether lipid metabolism (1)
- Glutathione metabolism (1)
- Glycerolipid metabolism (1)
- Glycerophospholipid metabolism (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Inositol phosphate metabolism (1)
- Leukocyte transendothelial migration (1)
- Linoleic acid metabolism (1)
- Long-term potentiation (1)
- Maturity onset diabetes of the young (1)
- Metabolism of xenobiotics by cytochrome P450 (1)
- N-Glycan biosynthesis (1)
- Non-homologous end-joining (1)
- Notch signaling pathway (1)
- Olfactory transduction (1)
- Pentose phosphate pathway (1)
- Phosphatidylinositol signaling system (1)
- RIG-I-like receptor signaling pathway (1)
- RNA degradation (1)
- Renin-angiotensin system (1)
- Sphingolipid metabolism (1)
- Systemic lupus erythematosus (1)
- TGF-beta signaling pathway (1)
- Ubiquitin mediated proteolysis (1)
- Vibrio cholerae infection (1)
- Viral myocarditis (1)
- alpha-Linolenic acid metabolism (1)
- mTOR signaling pathway (1)