Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Rabbit polyclonal MITF (Ab-180/73) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M). |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal p16-INK4a (Phospho-Ser152) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p16-INK4a around the phosphorylation site of serine 152 (G-P-SP-D-I). |
| Modifications | Phospho-specific |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Rabbit polyclonal CDK4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
Anti-Human IGF-I Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IGF-I |
Rabbit anti-AKT1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT1 |
Phospho-CDK6-Y13 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y13 of human CDK6 |
| Modifications | Phospho-specific |
Rabbit anti-BAD (Phospho-Ser136) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from mouse BAD around the phosphorylation site of serine136 (S-R-S[P]-A-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal PDGFR beta (Ab-1021) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PDGFR β around the phosphorylation site of tyrosine 1021 (N-D-YP-I-I). |
Rabbit polyclonal Raf1 (Ab-621) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P). |
Rabbit polyclonal Akt (Ab-129) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A). |
Rabbit polyclonal Akt (Ab-326) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R). |
Rabbit polyclonal B-RAF (Phospho-Ser446) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human B-RAF around the phosphorylation site of serine 446 (R-D-SP-S-D). |
| Modifications | Phospho-specific |
Rabbit anti-IGF1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human IGF1 |
Rabbit Polyclonal antibody to PIK3R3 (phosphoinositide-3-kinase, regulatory subunit 3 (gamma))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 192 and 427 of PIK3R3 |
Rabbit polyclonal AKT1/2/3 (Ab-315/316/312) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human AKT1/2/3 around the phosphorylation site of tyrosine 315/316/312 (P-E-YP-L-A). |
Rabbit polyclonal c-Met (Tyr1003) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Tyr1003, Mouse: Tyr1001, Rat: Tyr1004 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal IGF1R (Ab-1346) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China
