Germany
Japan
United Kingdom
China
Rabbit anti-MMP2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MMP2 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CLDN23 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN23 antibody: synthetic peptide directed towards the C terminal of human CLDN23. Synthetic peptide located within the following region: IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE |
Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707) |
Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1 |
F11R Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human F11R |
CTNND1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CTNND1 |
Rabbit anti-MAPK14 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human MAPK14 |
Phospho-VASP-S239 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S239 of human VASP |
| Modifications | Phospho-specific |
USD 450.00
In Stock
Rabbit Polyclonal Antibody against PIK3CG (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 518-547 amino acids from the Central region of human PI3KCG. |
Rabbit Polyclonal antibody to PIK3R3 (phosphoinositide-3-kinase, regulatory subunit 3 (gamma))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 192 and 427 of PIK3R3 |
Rabbit polyclonal p47 phox/NCF1 (Ab-345) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p47 phox around the phosphorylation site of serine 345 (P-Q-SP-P-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal p47 phox/NCF1 (Ab-359) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p47 phox around the phosphorylation site of serine 359 (Q-R-SP-K-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal Shc (Tyr427) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 427 (P-S-YP-V-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal Shc (Ab-349) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 349 (H-Q-YP-Y-N). |
Rabbit polyclonal p130 Cas (Tyr410) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human: Tyr410, Mouse: Tyr414, Rat: Tyr508 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p130 Cas around the phosphorylation site of tyrosine 410 (G-V-YP-A-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal PLCG1 (Ab-771) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PLCG1 around the phosphorylation site of tyrosine 771 (P-D-Y-G-A). |
Rabbit polyclonal Claudin 7 (Ab-210) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | he antiserum was produced against synthesized non-phosphopeptide derived from human Claudin 7 around the phosphorylation site of tyrosine 210 (S-K-E-YP-V). |
Mouse Anti-Human RAC1 Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-PTK2B (Phospho-Tyr402) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 402 (D-I-Y(p)-A-E) derived from Human Pyk2. |
| Modifications | Phospho-specific |
Rabbit polyclonal CTNA1 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CTNA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 30-59 amino acids from the N-terminal region of human CTNA1. |
USD 345.00
In Stock
Rabbit Polyclonal Anti-ACTN3 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN3 antibody: synthetic peptide directed towards the N terminal of human ACTN3. Synthetic peptide located within the following region: VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY |
Rabbit Polyclonal CXCR4 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a 15 amino acid peptide near the center of human CXCR4. The immunogen is located within amino acids 170 - 220 of CXCR4. |
Rabbit polyclonal p47 phox/NCF1 (Ser345) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p47 phox around the phosphorylation site of serine 345 (P-Q-SP-P-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal Shc (Tyr349) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Shc around the phosphorylation site of tyrosine349 (H-Q-YP-Y-N) |
| Modifications | Phospho-specific |
Rabbit polyclonal Claudin 5 (Tyr217) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Claudin 5 around the phosphorylation site of tyrosine 217 (K-N-YP-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-PIK3R5 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PIK3R5. |
Rabbit polyclonal PYK2 (Tyr579) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PYK2 around the phosphorylation site of tyrosine 579 (E-D-YP-Y-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-NOX3 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NOX3. |
Rabbit polyclonal beta Catenin antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus. |
Active filters
Applications
- IHC
Conjugates
- Unconjugated
Pathways
- Leukocyte transendothelial migration
Filter by
Category
Target Symbol
- PECAM1 (71)
- CD99 (50)
- CTNNB1 (47)
- PIK3CG (34)
- PIK3R5 (22)
- CTNND1 (20)
- PIK3CD (18)
- BCAR1 (16)
- VCAM1 (15)
- PIK3CA (14)
- VASP (13)
- MMP2 (11)
- PTK2 (11)
- CXCR4 (10)
- ITGAM (10)
- MAPK13 (10)
- MMP9 (10)
- SHC1 (10)
- MYL7 (9)
- ACTB (7)
- CDH5 (7)
- ACTN1 (6)
- CLDN3 (6)
- ICAM1 (6)
- MAPK14 (6)
- NCF4 (6)
- PRKCA (6)
- PXN (6)
- CLDN1 (5)
- F11R (5)
- PTK2B (5)
- ROCK2 (5)
- ACTN2 (4)
- CLDN5 (4)
- CLDN7 (4)
- CTNNA1 (4)
- CXCL12 (4)
- CYBB (4)
- ITGB1 (4)
- MAPK12 (4)
- MSN (4)
- NCF1 (4)
- NOX3 (4)
- PIK3R1 (4)
- ACTN4 (3)
- CLDN10 (3)
- CLDN4 (3)
- PTPN11 (3)
- ROCK1 (3)
- SIPA1 (3)
- CLDN11 (2)
- CLDN19 (2)
- CLDN23 (2)
- CLDN8 (2)
- EZR (2)
- ITGAL (2)
- ITGB2 (2)
- MYL9 (2)
- NCF2 (2)
- NOX1 (2)
- PIK3R3 (2)
- PLCG1 (2)
- PRKCB (2)
- RAC1 (2)
- RAP1A (2)
- RAP1B (2)
- RAPGEF3 (2)
- THY1 (2)
- VCL (2)
- ACTG1 (1)
- ACTN3 (1)
- ARHGAP5 (1)
- CDC42 (1)
- CLDN17 (1)
- CLDN2 (1)
- CLDN6 (1)
- CYBA (1)
- GNAI3 (1)
- ITGA4 (1)
- ITK (1)
- JAM2 (1)
- MAPK11 (1)
- MLLT4 (1)
- MYL12A (1)
- MYL12B (1)
- MYL2 (1)
- PIK3CB (1)
- PIK3R2 (1)
- PLCG2 (1)
- PRKCG (1)
- RAC2 (1)
- RAPGEF4 (1)
- VAV1 (1)
- VAV2 (1)
Reactivities
- Human (602)
- Mouse (398)
- Rat (371)
- Monkey (66)
- Dog (64)
- Bovine (11)
- Chicken (5)
- Xenopus (5)
- Rabbit (3)
- Rhesus Monkey (3)
- Cow (2)
- Horse (2)
- Pig (2)
- Porcine (2)
- X. tropicalis (2)
- Zebrafish (2)
- All Species (1)
- Avian (1)
- Bat (1)
- Canine (1)
- Chimpanzee (1)
- Fish (1)
- Gibbon (1)
- Gorilla (1)
- Guinea Pig (1)
- Hamster (1)
- Orang-Utan (1)
- Primate (1)
- Sheep (1)