Rabbit Polyclonal Anti-ILK Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ILK |
Rabbit Polyclonal Anti-ILK Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ILK |
Rabbit anti-CPT1A Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CPT1A |
Rabbit Polyclonal Anti-FABP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FABP2 |
Rabbit Polyclonal Anti-ACAA1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1. Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD |
PPARG Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | N term -peptide of human PPARG |
Rabbit Polyclonal UCP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | UCP1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human UCP1 (GenBank accession. |
Rabbit Polyclonal Anti-ME1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ME1 antibody was raised against a 16 amino acid peptide near the amino terminus of human ME1. |
Rabbit polyclonal Retinoid X Receptor gamma antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Retinoid X Receptor ? antibody. |
Rabbit anti-PPARD Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPARD |
Rabbit anti-ILK Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ILK |
Rabbit anti-PDPK1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant Protein of human PDPK1 |
Rabbit Polyclonal PCK1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit polyclonal anti-EHHADH antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EHHADH. |
Rabbit polyclonal SCP2 Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SCP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 358-385 amino acids from the Central region of human SCP2. |
Rabbit anti-ANGPTL4 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ANGPTL4 |
Rabbit Polyclonal Adiponectin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Adiponectin antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human adiponectin. The immunogen is located within the last 50 amino acids of Adiponectin. |
Rabbit Polyclonal LXR-A Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LXR-A antibody was raised against a 15 amino acid peptide from near the amino terminus human LXR-A. |
Rabbit Polyclonal antibody to Glycerol kinase 2 (glycerol kinase 2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 67 and 338 of Glycerol kinase 2 (Uniprot ID#Q14410) |
Rabbit polyclonal PDK1 (Tyr9) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PDK1 around the phosphorylation site of tyrosine 9 (Q-L-YP-D-A). |
Modifications | Phospho-specific |
Rabbit polyclonal ILK (Ser246) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ILK around the phosphorylation site of serine 246 (I-F-SP-H-P). |
Modifications | Phospho-specific |
Anti-FABP7 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-PDPK1 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.239~243 (A-N-S-F-V) derived from Human PDK1. |
Rabbit Polyclonal Adiponectin/Acrp30 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal sequence of human Adiponectin (between amino acids 200-244) [UniProt Q15848] |
Rabbit Polyclonal Adiponectin Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Adiponectin antibody was raised against a 15 amino acid peptide from near the amino terminus of human adiponectin. |
Rabbit polyclonal ILK (Ab-246) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ILK around the phosphorylation site of serine 246 (I-F-SP-H-P). |
USD 1,140.00
9 Weeks
Mouse monoclonal Anti-Cytochrome P450 4A11 Clone M25-P2A10
Applications | IHC, WB |
Reactivities | Drosophila, Human, Mouse, Rat, Xenopus |
Conjugation | Unconjugated |
Mouse monoclonal Anti-Cytochrome P450 8B1 Clone M15-P3B7
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against SORBS1
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-GTFPGNYVKPLYL, from the C Terminus of the protein sequence according to NP_006425.2; NP_056200.1; NP_001030126.1; NP_001030127.1; NP_001030128.1; NP_079267.1; NP_001030129.1. |
Goat Anti-PCK1 / PEPCKC (internal) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HVNWFRKDKEGK, from the internal region of the protein sequence according to NP_002582.3. |
Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI6A5 (formerly 6A5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPL mouse monoclonal antibody, clone OTI3C8 (formerly 3C8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPL mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPL mouse monoclonal antibody, clone OTI5C6 (formerly 5C6)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPL mouse monoclonal antibody, clone OTI6A10 (formerly 6A10)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPL mouse monoclonal antibody, clone OTI4F6 (formerly 4F6)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPL mouse monoclonal antibody, clone OTI3A10 (formerly 3A10)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPL mouse monoclonal antibody, clone OTI4G7 (formerly 4G7)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) SCP2 mouse monoclonal antibody, clone OTI1E4 (formerly 1E4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) SCP2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CPT1B mouse monoclonal antibody,clone OTI2A6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CPT1B mouse monoclonal antibody,clone OTI6B8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAA1 mouse monoclonal antibody,clone OTI4F1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPARD mouse monoclonal antibody,clone OTI4D10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACADM mouse monoclonal antibody,clone OTI2G7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACADM mouse monoclonal antibody,clone OTI10A5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACADM mouse monoclonal antibody,clone OTI9G10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |