Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit polyclonal IRS-1 (Ab-312) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Neuropeptide Y (NPY) (68-97) rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human, Rat |
| Immunogen | Synthetic Prepro-NPY 68-97 (C-PON). |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4). |
Rabbit Polyclonal Anti-LEP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS |
Rabbit anti-MTOR polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized non-phosphopeptide derived fromhuman mTOR around the phosphorylation site of serine 2448 (T-D-SP-Y-S). |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against AKT2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
TRAF2 Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TRAF2 |
Rabbit anti-TRADD Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TRADD |
Rabbit anti-AKT1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT1 |
Rabbit Polyclonal Anti-CPT1B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPT1B antibody: synthetic peptide directed towards the middle region of human CPT1B. Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA |
AKT1 (C-term) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Families
- Druggable Genome
Pathways
- Adipocytokine signaling pathway
Filter by
Target Symbol
- ADIPOQ (81)
- AKT1 (73)
- MTOR (51)
- IRS1 (34)
- MAPK9 (28)
- SOCS3 (27)
- MAPK8 (26)
- RELA (24)
- POMC (23)
- TNF (19)
- STAT3 (16)
- NFKBIA (15)
- CPT1B (14)
- PRKAA1 (14)
- AKT2 (13)
- CD36 (13)
- CHUK (13)
- IKBKG (13)
- STK11 (13)
- AKT3 (11)
- JAK2 (10)
- NFKB1 (9)
- NFKBIE (9)
- NPY (9)
- LEP (8)
- PRKCQ (8)
- TRAF2 (7)
- G6PC1 (6)
- PPARA (6)
- PRKAB1 (6)
- PTPN11 (6)
- TNFRSF1A (6)
- CPT1A (5)
- IKBKB (5)
- PRKAA2 (5)
- SLC2A1 (5)
- LEPR (4)
- PCK1 (4)
- SLC2A4 (4)
- TNFRSF1B (4)
- TRADD (4)
- ADIPOR1 (3)
- ADIPOR2 (3)
- IRS2 (3)
- PRKAG2 (3)
- ACSL4 (2)
- AGRP (2)
- CAMKK2 (2)
- PPARGC1A (2)
- RXRG (2)
- CAMKK1 (1)
- G6PC (1)
- IRS4 (1)
- MAPK10 (1)
- PRKAB2 (1)