Antibodies

View as table Download

Rabbit anti-SMAD5 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human SMAD5

SMAD1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SMAD1

Rabbit polyclonal SMAD3-S208 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3.

Rabbit Polyclonal Anti-DEPTOR Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR.

Rabbit polyclonal p44/42 MAPK antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERK1/2.

Rabbit polyclonal anti-TGF Beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β1 antibody.

Rabbit polyclonal Smad1 (Ser465) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Smad1 around the phosphorylation site of serine 465 (I-S-S-V-SP)
Modifications Phospho-specific

Rabbit polyclonal Smad1 (Ser187) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Smad1 around the phosphorylation site of serine 187 (P-H-SP-P-N).
Modifications Phospho-specific

Rabbit polyclonal Smad1 (Ab-465) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Smad1 around the phosphorylation site of serine 465 (I-S-S-V-SP).

Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody

Applications IHC, WB
Reactivities Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein.

Anti-SMAD3 (Phospho-Ser425) Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 425 (C-S-S-V-S(p)) derived from Human Smad3.
Modifications Phospho-specific

Anti-Human BMP-7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CHO cells derived Recombinant Human BMP-7

Rabbit anti-TGFB1 polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen peptide coupled to KLH

Rabbit polyclonal Smad3 (Ab-204) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Smad3 around the phosphorylation site of serine 204 (A-G-SP-P-N).

Rabbit polyclonal MAPK3 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3.

Rabbit Polyclonal Anti-SMAD6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMAD6 antibody: synthetic peptide directed towards the N terminal of human SMAD6. Synthetic peptide located within the following region: APRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKR

Rabbit Polyclonal Anti-SMAD1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SMAD1

Rabbit anti-SMAD3 (Phospho-Ser425) polyclonal antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized phosphopeptide derived from humanSmad3 around the phosphorylation site of serine 425 (C-S-S-V-SP).
Modifications Phospho-specific

Rabbit polyclonal anti-SMAD3 antibody

Applications IHC, WB
Reactivities Human, Xenopus, Xenopus Tropicalis, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of human SMAD3 protein.

Anti-SMAD2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.218~222 (P-E-T-P-P) derived from Human Smad2.

Anti-SMAD3 Rabbit Polyclonal Antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.423~427 (C-S-S-V-S) derived from Human Smad3.

Rabbit Polyclonal Anti-BMP7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ

Anti-Human BMP-2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BMP-2

Anti-SP1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 609-622 amino acids of human Sp1 transcription factor

Anti-SP1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 609-622 amino acids of human Sp1 transcription factor

Anti-ID4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 19-38 amino acids of Human inhibitor of DNA binding 4, dominant negative helix-loop-helix protein

Anti-ID4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 19-38 amino acids of Human inhibitor of DNA binding 4, dominant negative helix-loop-helix protein

Anti-SMAD5 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 300 amino acids of human SMAD family member 5

Anti-SMAD5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 300 amino acids of human SMAD family member 5

Anti-TGFB1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 30-278 amino acids of human transforming growth factor, beta 1

Rabbit Polyclonal Anti-ACVR1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACVR1

Rabbit Polyclonal Anti-ID2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ID2

Rabbit Polyclonal Anti-SMURF2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SMURF2

Rabbit Polyclonal Anti-SMAD3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SMAD3

Rabbit Polyclonal Anti-SMAD9 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SMAD9

Rabbit Polyclonal Anti-BMP6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human BMP6

Rabbit Polyclonal Anti-ID2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ID2

Rabbit Polyclonal Anti-ID3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ID3

Rabbit Polyclonal Anti-ID4 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ID4