Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal Antibody against PROX1 (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PROX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 185-214 amino acids from the Central region of human PROX1. |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit polyclonal KLF5 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This KLF5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 341-370 amino acids from the C-terminal region of human KLF5. |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal Antibody against SOX2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2. |
Rabbit polyclonal KLF4 Antibody (N-term C74)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4. |
Rabbit polyclonal SOX-9 (Ser181) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SOX-9 around the phosphorylation site of serine 181 (R-K-SP-V-K). |
| Modifications | Phospho-specific |
mouse Anti-Prox1 Antibody
| Applications | IHC |
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein. |
Rabbit polyclonal PAX3 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PAX3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 98-126 amino acids from the N-terminal region of human PAX3. |
Rabbit Polyclonal anti-GLI2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE |
Rabbit polyclonal Smad3 (Ab-204) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Smad3 around the phosphorylation site of serine 204 (A-G-SP-P-N). |
Rabbit polyclonal FOXA2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-157 amino acids from the Central region of human FOXA2. |
Rabbit polyclonal FOXA2 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-407 amino acids from the C-terminal region of human FOXA2. |
Rabbit Polyclonal Anti-PAX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX3 antibody: synthetic peptide directed towards the C terminal of human PAX3. Synthetic peptide located within the following region: GGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYC |
Rabbit Polyclonal Antibody against CDX2 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human CDX2. |
Goat Polyclonal Antibody against PAX3
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence TTLAGAVPRMM-C, from the N Terminus of the protein sequence according to NP_000429.2; NP_039230.1; NP_852122;.1 NP_852123.1; NP_852124.1; NP_852125.1; NP_852126.1. |
Rabbit anti-SMAD3 (Phospho-Ser425) polyclonal antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanSmad3 around the phosphorylation site of serine 425 (C-S-S-V-SP). |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Mouse
Applications
- IHC
Families
- Embryonic stem cells
Filter by
Category
Target Symbol
- GLI1 (39)
- CDX2 (19)
- MYC (17)
- PDX1 (13)
- KLF5 (12)
- SOX9 (12)
- GLI2 (11)
- OTX2 (10)
- FOXA2 (9)
- SMAD3 (8)
- BDNF (7)
- SOX2 (7)
- GATA4 (6)
- GRB7 (6)
- BMP4 (5)
- CD44 (4)
- KLF4 (4)
- PAX3 (4)
- HNF1B (3)
- POU5F1 (3)
- PROX1 (3)
- DPPA2 (2)
- EGF (2)
- FGF7 (2)
- GATA6 (2)
- PAX7 (2)
- SMAD2 (2)
- BMP2 (1)
- BMP6 (1)
- CCN4 (1)
- CD9 (1)
- FGF21 (1)
- FGF4 (1)
- GDF3 (1)
- GDF9 (1)
- GLI3 (1)
- IGFBP1 (1)
- KIT (1)
- NANOG (1)
- PDGFC (1)
- TAT (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (91)
- Hedgehog signaling pathway (58)
- Basal cell carcinoma (57)
- TGF-beta signaling pathway (34)
- MAPK signaling pathway (30)
- Cell cycle (27)
- Colorectal cancer (27)
- Wnt signaling pathway (27)
- Chronic myeloid leukemia (25)
- Maturity onset diabetes of the young (25)
- Acute myeloid leukemia (19)
- Bladder cancer (19)
- Endometrial cancer (19)
- ErbB signaling pathway (19)
- Jak-STAT signaling pathway (17)
- Small cell lung cancer (17)
- Thyroid cancer (17)
- Type II diabetes mellitus (13)
- Pancreatic cancer (12)
- Adherens junction (10)
- Hematopoietic cell lineage (7)
- Huntington's disease (7)
- Melanoma (7)
- Neurotrophin signaling pathway (7)
- Regulation of actin cytoskeleton (7)
- Cytokine-cytokine receptor interaction (5)
- ECM-receptor interaction (4)
- Endocytosis (4)
- Focal adhesion (3)
- Gap junction (3)
- Prostate cancer (3)
- Glioma (2)
- Melanogenesis (2)
- Non-small cell lung cancer (2)
- Cysteine and methionine metabolism (1)
- Metabolic pathways (1)
- Phenylalanine (1)
- Phenylalanine metabolism (1)
- Tyrosine metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- tyrosine and tryptophan biosynthesis (1)