Rabbit Polyclonal Anti-NR2F6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV |
Rabbit Polyclonal Anti-NR1I3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the N terminal of human NR1I3. Synthetic peptide located within the following region: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFA |
Rabbit Polyclonal Anti-NR4A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR4A1 antibody: synthetic peptide directed towards the middle region of human NR4A1. Synthetic peptide located within the following region: FQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHL |
Rabbit Polyclonal Anti-NR1I3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the middle region of human NR1I3. Synthetic peptide located within the following region: PVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDG |
Rabbit Polyclonal Anti-RARB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RARB antibody: synthetic peptide directed towards the C terminal of human RARB. Synthetic peptide located within the following region: SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS |
Rabbit Polyclonal Anti-NR3C2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR3C2 antibody: synthetic peptide directed towards the middle region of human NR3C2. Synthetic peptide located within the following region: RRKNCPACRLQKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPP |
Rabbit Polyclonal Anti-NR0B1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the N terminal of human NR0B1. Synthetic peptide located within the following region: TSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCC |
Rabbit Polyclonal Anti-PGRMC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGRMC1 antibody: synthetic peptide directed towards the N terminal of human PGRMC1. Synthetic peptide located within the following region: MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ |
Rabbit Polyclonal Anti-PPARD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARD antibody: synthetic peptide directed towards the n terminal of human PPARD. Synthetic peptide located within the following region: MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSS |
Rabbit Polyclonal Anti-PPARD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARD antibody: synthetic peptide directed towards the C terminal of human PPARD. Synthetic peptide located within the following region: AQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY |
Rabbit anti Estrogen Receptor alpha (ER-alpha) Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human estrogen receptor protein. This sequence is identical to human, Gorilla, Bovine, etc. |
Rabbit anti Progesterone Receptor (PR) Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to C-terminus of human Progesterone receptor. This sequence is identical within human, mouse, rat, chicken, bovine and dog origins. |
USD 545.00
2 Weeks
USD 435.00
2 Weeks
Estrogen Receptor 1 (ESR1) (B region) mouse monoclonal antibody, clone ER-B10, Ascites
| Applications | IHC |
| Reactivities | Human |
Estrogen Receptor 1 (ESR1) pSer104 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Estrogen Receptor 1 (ESR1) pSer118 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Estrogen Receptor 1 (ESR1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Estrogen Receptor 1 (ESR1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Estrogen Receptor 1 (ESR1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
ESRRB / ERR-Beta Rabbit Polyclonal (Ligand-binding Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | ESRRB / ERR Beta antibody was raised against synthetic 15 amino acid peptide from ligand-binding domain of human ESRRB. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum (100%); Mouse, Rat, Elephant, Turkey, Chicken, Lizard (93%); Bat (87%); Stickleback, Medaka, Pufferfish, Zebrafish (80%). |
HNF4G / HNF4 Gamma Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | HNF4G / HNF4 Gamma antibody was raised against synthetic 16 amino acid peptide from internal region of human HNF4G. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Elephant, Panda, Dog (94%); Bat, Horse, Turkey, Chicken (88%); Rat, Pig, Opossum, Platypus (81%). |
NR1D1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Immunogen | NR1D1 antibody was raised against synthetic 17 amino acid peptide from internal region of human NR1D1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig (100%); Bat, Opossum, Lizard (94%). |
NR1D2 Rabbit Polyclonal (Ligand-binding Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gorilla, Gibbon |
| Immunogen | NR1D2 antibody was raised against synthetic 19 amino acid peptide from ligand-binding domain of human NR1D2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Hamster, Elephant (89%); Mouse, Rat, Panda, Bat, Dog, Rabbit, Horse (84%). |
NR1D2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | NR1D2 antibody was raised against synthetic 16 amino acid peptide from N-terminus of human NR1D2. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey, Marmoset, Panda, Dog (94%); Bovine, Bat, Horse (88%); Elephant (81%). |
NR2E3 / PNR Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | NR2E3 / PNR antibody was raised against synthetic 18 amino acid peptide from near N-terminus of human NR2E3. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset, Mouse, Hamster (94%); Bovine (89%); Elephant, Pig (83%). |
NR2E3 / PNR Rabbit Polyclonal (Ligand-binding Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Chimpanzee, Gorilla, Hamster, Horse, Human, Mouse, Pig |
| Conjugation | Unconjugated |
| Immunogen | NR2E3 / PNR antibody was raised against synthetic 19 amino acid peptide from ligand-binding domain of human NR2E3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Mouse, Hamster, Elephant, Panda, Bovine, Bat, Horse, Pig (100%); Marmoset (95%). |
Goat Anti-AHR Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PENQKHGLNPQSA, from the internal region of the protein sequence according to NP_001612.1. |
Phospho-AR-S650 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S650 of human AR |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ESRRA Antibody (Ligand-binding Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ESRRA / ERR Alpha antibody was raised against synthetic 15 amino acid peptide from ligand-binding domain of human ESRRA. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Bat, Dog, Horse, Pig (100%). |
Rabbit Polyclonal Anti-NR2F6 Antibody (Ligand-binding Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | EAR2 / NR2F6 antibody was raised against synthetic 16 amino acid peptide from ligand-binding domain of human NR2F6. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Pig, Platypus, Xenopus, Stickleback, Pufferfish, Zebrafish (100%); Opossum (94%). |
Rabbit Polyclonal Anti-ESRRG Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | ESRRG / ERR Gamma antibody was raised against synthetic 16 amino acid peptide from near N-terminus of human ESRRG / ERR3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit, Opossum, Turkey, Chicken, Platypus, Lizard, Xenopus, Zebrafish (100%); Medaka, Pufferfish, Stickleback (94%). |
Rabbit Polyclonal Anti-ESRRG Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ESRRG / ERR Gamma antibody was raised against synthetic 15 amino acid peptide from C-terminus of human ESRRG / ERR3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Platypus, Lizard (100%); Bat, Xenopus, Zebrafish (93%); Stickleback, Medaka, Pufferfish (87%). |
Rabbit Polyclonal Anti-THRA Antibody (Ligand-binding Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | THRA / THR Alpha antibody was raised against synthetic 16 amino acid peptide from ligand-binding domain of human THRA. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Horse (94%); Hamster (88%); Rat (81%). |
Rabbit Polyclonal Anti-ESRRG Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ESRRG / ERR Gamma antibody was raised against synthetic 14 amino acid peptide from N-terminus of human ESRRG / ERR3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit (100%); Opossum, Turkey, Chicken, Platypus, Lizard, Xenopus (93%); Zebrafish (86%). |
Rabbit Polyclonal Anti-NR4A1 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | NR4A1 / NUR77 antibody was raised against synthetic 16 amino acid peptide from N-terminal to DNA binding domain of human NUR77. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Orangutan, Marmoset, Elephant (88%); Bovine, Panda, Horse (81%). |
Rabbit Polyclonal Anti-NR4A1 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | NR4A1 / NUR77 antibody was raised against synthetic 15 amino acid peptide from N-terminal to DNA binding domain of human NUR77. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Hamster (100%); Marmoset, Elephant, Panda, Bovine, Dog, Horse (93%); Bat, Rabbit (87%). |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
4 Weeks
Germany
Japan
United Kingdom
China
