Antibodies

View as table Download

Rabbit anti-CDK4 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Center-peptide of human CDK4

Rabbit anti-CDK1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Center-peptide of human CDK1

Phospho-CDK1-T161 Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T161 of human CDK1
Modifications Phospho-specific

Phospho-CDK2-T160 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T160 of human CDK2
Modifications Phospho-specific

Rabbit polyclonal CDK4 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4.

Phospho-CDK6-Y13 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y13 of human CDK6
Modifications Phospho-specific

CDK6 mouse monoclonal antibody, clone 8H4, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Rat

Chk2 (CHEK2) pThr387 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Immunogen Synthetic phosphopeptide derived from human Chk2 around the phosphorylation site of Threonine 387.

Rabbit polyclonal Chk1 (Ser296) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Chk1 around the phosphorylation site of serine 296 (I-Q-SP-N-L).
Modifications Phospho-specific

CDK1 / CDC2 Mouse Monoclonal (26E11) Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CDK6 pTyr13 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen The antiserum was produced against synthesized phosphopeptide derived from Human CDK6 around the phosphorylation site of Tyrosine 13 (Q-Q-Yp-E-C).

CDK6 pTyr13 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen The antiserum was produced against synthesized phosphopeptide derived from Human CDK6 around the phosphorylation site of Tyrosine 13 (Q-Q-Yp-E-C).

Chk1 (CHEK1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human

Rabbit Polyclonal ATM Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ATM antibody was raised against a peptide corresponding to 14 amino acids near the carboxy terminus of human ATM.

Rabbit polyclonal Chk2 (Thr387) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Chk2 around the phosphorylation site of threonine 387 (C-G-TP-P-T).
Modifications Phospho-specific

Anti-CDK6 (phospho-Tyr24) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 24 (G-A-Y(p)-G-K) derived from Human CDK6.
Modifications Phospho-specific

Rabbit Polyclonal Anti-CDK1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM

Rabbit Polyclonal ATM Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A fragment of the human ATM protein corresponding to the C-terminus (within the last third of the protein sequence). [UniProt# Q13315]

CDK1 mouse monoclonal antibody, clone IMD-34, Purified

Applications IHC, WB
Reactivities Chicken, Human, Mouse, Rabbit, Rat

Rabbit Polyclonal Antibody against CDC2 (T14)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1.

Rabbit polyclonal Chk2 (Thr68) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Chk2 around the phosphorylation site of Threonine 68 (V-S-TP-Q-E).
Modifications Phospho-specific

Rabbit polyclonal Chk2 (Ab-68) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Chk2 around the phosphorylation site of threonine 68.

Rabbit polyclonal anti-cdk2 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Anti-cdk2 antbody was prepared from whole rabbit serum by repeated immunizations with a synthetic peptide corresponding to the C-terminus of the human cdk-2 protein conjugated to Keyhole Limpet Hemocyanin (KLH).

Anti-CDK6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around aa.22~26 (G-A-Y-G-K) derived from Human CDK6.

Rabbit anti CDC2 Polyclonal Antibody

Applications IHC, WB
Reactivities Bovine, Chicken, Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of CDC2 protein from human, rat and mouse origins

ATM pSer1981 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human
Immunogen Synthetic phosphopeptide derived from human ATM around the phosphorylation site of Serine 1981.

CDK1 pTyr15 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

Chk1 (CHEK1) pSer345 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

Chk1 (CHEK1) pSer317 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

Chk2 (CHEK2) pThr68 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

ATM rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 1957-2006 of Human ATM.

Chk1 (CHEK1) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

Chk1 (CHEK1) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

Chk2 (CHEK2) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

Chk2 (CHEK2) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

Rabbit anti-ATM (Phospho-Ser1981) polyclonal antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanATM around the phosphorylation site of serine 1981 (E-G-SP-Q-S).
Modifications Phospho-specific

Rabbit polyclonal ATR (Ser428) antibody(Phospho-specific)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human ATR around the phosphorylation site of serine 428 (G-I-SP-P-K).
Modifications Phospho-specific

Carrier-free (BSA/glycerol-free) CHEK2 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)

Applications FC, IHC, IP, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CHEK2 mouse monoclonal antibody, clone OTI4C10 (formerly 4C10)

Applications FC, IHC, IP, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CHEK2 mouse monoclonal antibody, clone OTI10G7 (formerly 10G7)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CHEK2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications FC, IHC, IP, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CHEK2 mouse monoclonal antibody, clone OTI5C4 (formerly 5C4)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CHEK2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-CDK1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 219-233 amino acids of Human Cyclin-dependent kinase 1

Anti-CDK6 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 13-300 amino acids of Human Cyclin-dependent kinase 6

Anti-CDK6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 13-300 amino acids of human Cyclin-dependent kinase 6

CDK4 Antibody - C-terminal region

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

CHEK2 (CHK2) mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)

Applications FC, IHC, IP, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated