Rabbit anti-CDK4 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Center-peptide of human CDK4 |
Rabbit anti-CDK4 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Center-peptide of human CDK4 |
Rabbit anti-CDK1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Center-peptide of human CDK1 |
Phospho-CDK1-T161 Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T161 of human CDK1 |
Modifications | Phospho-specific |
Phospho-CDK2-T160 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T160 of human CDK2 |
Modifications | Phospho-specific |
Rabbit polyclonal CDK4 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
Phospho-CDK6-Y13 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y13 of human CDK6 |
Modifications | Phospho-specific |
CDK6 mouse monoclonal antibody, clone 8H4, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Rat |
Chk2 (CHEK2) pThr387 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic phosphopeptide derived from human Chk2 around the phosphorylation site of Threonine 387. |
Rabbit polyclonal Chk1 (Ser296) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Chk1 around the phosphorylation site of serine 296 (I-Q-SP-N-L). |
Modifications | Phospho-specific |
CDK1 / CDC2 Mouse Monoclonal (26E11) Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CDK6 pTyr13 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from Human CDK6 around the phosphorylation site of Tyrosine 13 (Q-Q-Yp-E-C). |
CDK6 pTyr13 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from Human CDK6 around the phosphorylation site of Tyrosine 13 (Q-Q-Yp-E-C). |
Chk1 (CHEK1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal ATM Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ATM antibody was raised against a peptide corresponding to 14 amino acids near the carboxy terminus of human ATM. |
Rabbit polyclonal Chk2 (Thr387) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Chk2 around the phosphorylation site of threonine 387 (C-G-TP-P-T). |
Modifications | Phospho-specific |
Anti-CDK6 (phospho-Tyr24) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of tyrosine 24 (G-A-Y(p)-G-K) derived from Human CDK6. |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDK1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
Rabbit Polyclonal ATM Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A fragment of the human ATM protein corresponding to the C-terminus (within the last third of the protein sequence). [UniProt# Q13315] |
ATR (2545-2645) mouse monoclonal antibody, clone 1E9, Purified
Applications | ELISA, IHC |
Reactivities | Human |
CDK1 mouse monoclonal antibody, clone IMD-34, Purified
Applications | IHC, WB |
Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
Rabbit Polyclonal Antibody against CDC2 (T14)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1. |
Rabbit polyclonal Chk2 (Thr68) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Chk2 around the phosphorylation site of Threonine 68 (V-S-TP-Q-E). |
Modifications | Phospho-specific |
Rabbit polyclonal Chk2 (Ab-68) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Chk2 around the phosphorylation site of threonine 68. |
Rabbit polyclonal anti-cdk2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Anti-cdk2 antbody was prepared from whole rabbit serum by repeated immunizations with a synthetic peptide corresponding to the C-terminus of the human cdk-2 protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Anti-CDK6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.22~26 (G-A-Y-G-K) derived from Human CDK6. |
Mouse Monoclonal Chk2 Antibody (73C175.1.1)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit anti CDC2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Bovine, Chicken, Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the C-terminus of CDC2 protein from human, rat and mouse origins |
ATM pSer1981 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |
Immunogen | Synthetic phosphopeptide derived from human ATM around the phosphorylation site of Serine 1981. |
CDK1 pTyr15 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Chk1 (CHEK1) pSer345 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Chk1 (CHEK1) pSer317 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Chk2 (CHEK2) pThr68 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
ATM rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 1957-2006 of Human ATM. |
Chk1 (CHEK1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Chk1 (CHEK1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Chk2 (CHEK2) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Chk2 (CHEK2) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Rabbit anti-ATM (Phospho-Ser1981) polyclonal antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanATM around the phosphorylation site of serine 1981 (E-G-SP-Q-S). |
Modifications | Phospho-specific |
Rabbit polyclonal ATR (Ser428) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ATR around the phosphorylation site of serine 428 (G-I-SP-P-K). |
Modifications | Phospho-specific |
Carrier-free (BSA/glycerol-free) CHEK2 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CHEK2 mouse monoclonal antibody, clone OTI4C10 (formerly 4C10)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CHEK2 mouse monoclonal antibody, clone OTI10G7 (formerly 10G7)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CHEK2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CHEK2 mouse monoclonal antibody, clone OTI5C4 (formerly 5C4)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CHEK2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Anti-CDK1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 219-233 amino acids of Human Cyclin-dependent kinase 1 |
Anti-CDK6 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 13-300 amino acids of Human Cyclin-dependent kinase 6 |
Anti-CDK6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 13-300 amino acids of human Cyclin-dependent kinase 6 |
CDK4 Antibody - C-terminal region
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CHEK2 (CHK2) mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |