Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 51 results

Page 1 of 2

(reset)

COX4 (COX4I1) Mouse Monoclonal Antibody [Clone ID: 4D11-B3-E8]

TA346921

USD 380.00

4 Weeks

Mouse Monoclonal COX IV Antibody

Applications	FC, IF, IHC, IP, WB
Reactivities	Goat, Hamster, Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ATP6V0A2 Rabbit Polyclonal Antibody

TA346466

USD 475.00

5 Days

Rabbit Polyclonal Anti-ATP6V0A2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2. Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Cytochrome b c1 complex subunit 9 (UQCR10) Rabbit Polyclonal Antibody

TA335305

USD 375.00

5 Days

Rabbit Polyclonal Anti-UCRC Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

1 / 2

2 / 2

Previous Next

COX4 (COX4I1) Rabbit Polyclonal Antibody

TA301446

USD 457.00

In Stock

Rabbit polyclonal anti-COX IV antibody, Loading control

Applications	IHC, WB
Reactivities	Human, Mouse, Bovine, Primate, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073]

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ATP5MC3 Rabbit Polyclonal Antibody

TA313490

USD 345.00

In Stock

Rabbit polyclonal anti-ATP5G3 antibody

Applications	IF, IHC
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human ATP5G3.

1 / 2

2 / 2

Previous Next

COX7A2 Rabbit Polyclonal Antibody

TA316638

USD 425.00

5 Days

COX7A2 Rabbit Polyclonal (N-Terminus) Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	COX7A2 antibody was raised against synthetic peptide from human COX7S/A2 (aa1-50).

COX4 (COX4I1) Rabbit Polyclonal Antibody

TA326265

USD 345.00

In Stock

Rabbit polyclonal COX41 antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from N-terminal of human COX41.

1 / 2

2 / 2

Previous Next

COX4 (COX4I1) (154-166) Goat Polyclonal Antibody

AP22551PU-N

USD 440.00

2 Weeks

COX4 (COX4I1) (154-166) goat polyclonal antibody, Aff - Purified

Applications	ELISA, IHC, WB
Reactivities	Human, Monkey
Immunogen	Synthetic peptide from C-term of human COX4I1

1 / 3

2 / 3

3 / 3

Previous Next

COX10 (C-term) Rabbit Polyclonal Antibody

AP51029PU-N

USD 450.00

2 Weeks

COX10 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 386-414 amino acids from the C-terminal region of human COX1

1 / 3

2 / 3

3 / 3

Previous Next

COX6A1 (Center) Rabbit Polyclonal Antibody

AP51033PU-N

USD 450.00

2 Weeks

COX6A1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 50 - 78 amino acids from the Center region of human COX6A1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

NDUFA11 (Center) Rabbit Polyclonal Antibody

AP52835PU-N

USD 450.00

2 Weeks

NDUFA11 (Center) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 71-100 amino acids from the Central region of human NDUFA11

1 / 2

2 / 2

Previous Next

NDUFB5 Rabbit Polyclonal Antibody

TA308225

USD 415.00

5 Days

Rabbit Polyclonal antibody to NDUFB5 (NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region within amino acids 126 and 189 of NDUFB5 (Uniprot ID#O43674)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

COX4 (COX4I1) Rabbit Polyclonal Antibody

TA308869

USD 415.00

5 Days

Rabbit Polyclonal antibody to COX4 (cytochrome c oxidase subunit IV isoform 1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 169 of COX4 (Uniprot ID#P13073)

1 / 3

2 / 3

3 / 3

Previous Next

ATP5MC2 Rabbit Polyclonal Antibody

TA313489

USD 345.00

In Stock

Rabbit polyclonal anti-ATP5G2 antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human ATP5G2.

MT ND1 Rabbit Polyclonal Antibody

TA314215

USD 345.00

4 Weeks

Rabbit polyclonal anti-MT-ND1 antibody

Applications	IHC, WB
Reactivities	Human
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human MT-ND1.

1 / 2

2 / 2

Previous Next

NDUFA3 Rabbit Polyclonal Antibody

TA314234

USD 345.00

In Stock

Rabbit polyclonal anti-NDUFA3 antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human NDUFA3.

NDUFB1 Rabbit Polyclonal Antibody

TA314238

USD 345.00

In Stock

Rabbit polyclonal anti-NDUFB1 antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human NDUFB1.

ATP6V0B (Center) Rabbit Polyclonal Antibody

AP50303PU-N

USD 450.00

2 Weeks

ATP6V0B (Center) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 111-139 amino acids from the Central region of human ATP6V0B

1 / 2

2 / 2

Previous Next

COX4 (COX4I1) (N-term) Rabbit Polyclonal Antibody

AP51031PU-N

USD 450.00

2 Weeks

COX4 (COX4I1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 32~62 amino acids from the N-terminal region of human COX4I1

1 / 2

2 / 2

Previous Next

COX7A2L (Center) Rabbit Polyclonal Antibody

AP51037PU-N

USD 450.00

2 Weeks

COX7A2L (Center) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse
Immunogen	KLH conjugated synthetic peptide between 36-65 amino acids from the Central region of human COX7A2L

1 / 3

2 / 3

3 / 3

Previous Next

NDUFC2 (C-term) Rabbit Polyclonal Antibody

AP52843PU-N

USD 450.00

2 Weeks

NDUFC2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 93-123 amino acids from the C-terminal region of human NDUFC2

1 / 2

2 / 2

Previous Next

COX15 Rabbit Polyclonal Antibody

TA339409

USD 310.00

5 Days

Rabbit Polyclonal Anti-COX15 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-COX15 antibody: synthetic peptide directed towards the N terminal of human COX15. Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY

1 / 3

2 / 3

3 / 3

Previous Next

ATP5MF Rabbit Polyclonal Antibody

AP20619PU-N

USD 370.00

2 Weeks

ATP5MF rabbit polyclonal antibody, Aff - Purified

Applications	IHC
Reactivities	Human

1 / 2

2 / 2

Previous Next

NDUFC2 Rabbit Polyclonal Antibody

TA314239

USD 345.00

4 Weeks

Rabbit polyclonal anti-NDUC2 antibody

Applications	IHC
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human NDUC2.

Cytochrome C Oxidase subunit VIc (COX6C) Mouse Monoclonal Antibody [Clone ID: OTI4A5]

CF506178

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) COX6C mouse monoclonal antibody,clone OTI4A5

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Cytochrome C Oxidase subunit VIc (COX6C) Mouse Monoclonal Antibody [Clone ID: OTI4B11]

CF506179

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) COX6C mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

NDUFA4L2 Mouse Monoclonal Antibody [Clone ID: OTI5C10]

CF810602

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NDUFA4L2 mouse monoclonal antibody,clone OTI5C10

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

NDUFA4L2 Mouse Monoclonal Antibody [Clone ID: OTI2E7]

CF810611

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NDUFA4L2 mouse monoclonal antibody,clone OTI2E7

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

COX8A Rabbit Polyclonal Antibody

TA322804

USD 345.00

In Stock

Anti-COX8A Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Full length fusion protein

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

COX10 Rabbit Polyclonal Antibody

TA323193

USD 345.00

In Stock

Anti-COX10 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to N terminal 300 amino acids of Human COX10 homolog, cytochrome c oxidase assembly protein, heme A: farnesyltransferase

COX11 Rabbit Polyclonal Antibody

TA323960

USD 345.00

4 Weeks

Anti-COX11 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 115-276 amino acids of human cytochrome c oxidase assembly homolog 11 (yeast)

1 / 3

2 / 3

3 / 3

Previous Next

NDUFA1 Rabbit Polyclonal Antibody

TA350206

USD 345.00

In Stock

Rabbit Polyclonal Anti-NDUFA1 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human NDUFA1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

NDUFA4 Rabbit Polyclonal Antibody

TA351429

USD 345.00

2 Weeks

Rabbit Polyclonal Anti-NDUFA4 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human NDUFA4

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

COX4 (COX4I1) Rabbit Polyclonal Antibody

TA352009

USD 345.00

In Stock

Rabbit Polyclonal Anti-COX4I1 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human COX4I1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

COX4 (COX4I1) Rabbit Polyclonal Antibody

TA356212

USD 300.00

5 Days

COX4I1 Antibody - N-terminal region

Applications	IHC, IP, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human COX4I1

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Cytochrome C Oxidase subunit VIc (COX6C) Mouse Monoclonal Antibody [Clone ID: OTI4A5]

TA506178

USD 379.00

In Stock

COX6C mouse monoclonal antibody,clone OTI4A5

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Cytochrome C Oxidase subunit VIc (COX6C) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A5]

TA506178AM

USD 420.00

4 Weeks

COX6C mouse monoclonal antibody,clone OTI4A5, Biotinylated

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Cytochrome C Oxidase subunit VIc (COX6C) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A5]

TA506178BM

USD 420.00

4 Weeks

COX6C mouse monoclonal antibody,clone OTI4A5, HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Cytochrome C Oxidase subunit VIc (COX6C) Mouse Monoclonal Antibody [Clone ID: OTI4A5]

TA506178S

USD 159.00

2 Days

COX6C mouse monoclonal antibody,clone OTI4A5

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Cytochrome C Oxidase subunit VIc (COX6C) Mouse Monoclonal Antibody [Clone ID: OTI4B11]

TA506179

USD 379.00

In Stock

COX6C mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Cytochrome C Oxidase subunit VIc (COX6C) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B11]

TA506179AM

USD 420.00

5 Days

COX6C mouse monoclonal antibody,clone 4B11, Biotinylated

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Cytochrome C Oxidase subunit VIc (COX6C) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B11]

TA506179BM

USD 420.00

5 Days

COX6C mouse monoclonal antibody,clone 4B11, HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Cytochrome C Oxidase subunit VIc (COX6C) Mouse Monoclonal Antibody [Clone ID: OTI4B11]

TA506179S

USD 159.00

In Stock

COX6C mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

NDUFA4L2 Mouse Monoclonal Antibody [Clone ID: OTI5C10]

TA810602

USD 379.00

In Stock

NDUFA4L2 mouse monoclonal antibody,clone OTI5C10

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

NDUFA4L2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C10]

TA810602AM

USD 420.00

4 Weeks

NDUFA4L2 mouse monoclonal antibody,clone OTI5C10, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

NDUFA4L2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C10]

TA810602BM

USD 420.00

4 Weeks

NDUFA4L2 mouse monoclonal antibody,clone OTI5C10, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

NDUFA4L2 Mouse Monoclonal Antibody [Clone ID: OTI5C10]

TA810602S

USD 159.00

2 Days

NDUFA4L2 mouse monoclonal antibody,clone OTI5C10

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

NDUFA4L2 Mouse Monoclonal Antibody [Clone ID: OTI2E7]

TA810611

USD 379.00

In Stock

NDUFA4L2 mouse monoclonal antibody,clone OTI2E7

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

NDUFA4L2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E7]

TA810611AM

USD 420.00

4 Weeks

NDUFA4L2 mouse monoclonal antibody,clone OTI2E7, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

NDUFA4L2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E7]

TA810611BM

USD 420.00

4 Weeks

NDUFA4L2 mouse monoclonal antibody,clone OTI2E7, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

1 - 50 of 51 results

Page 1 of 2