Mouse Monoclonal TLR4 Antibody (76B357.1)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Squirrel |
Conjugation | Unconjugated |
Mouse Monoclonal TLR4 Antibody (76B357.1)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Squirrel |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ITGB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ITGB1 |
Rabbit Polyclonal anti-TLR4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Developed against a synthetic peptide corresponding to amino acids 420-435 of human TLR4. |
Rabbit anti-CDH1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CDH1 |
Rabbit Polyclonal Anti-TLR4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TLR4 |
E Cadherin (CDH1) mouse monoclonal antibody, clone 3F4, Purified
Applications | ELISA, IF, IHC, PLA, WB |
Reactivities | Human |
E Cadherin (CDH1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 840-880 of Human E-cadherin. |
Rabbit Polyclonal Antibody against CD14 (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 292-322 amino acids from the C-terminal region of human CD14. |
CD14 (71-84) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from an internal region of human CD14 (NP_000582.1) |
E Cadherin (CDH1) (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from Human E-cadherin. |
Rabbit Polyclonal Antibody against CD14 (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human CD14. |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
Modifications | Phospho-specific |
Rabbit Anti-Human TLR5 Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TLR5 antibody was raised against synthetic peptide from human TLR5. |
Rabbit Polyclonal TLR4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the mouse TLR4 protein (between residues 400-450) [NP_612564] |
Mouse Monoclonal TLR5 Antibody (19D759.2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Canine |
Conjugation | Unconjugated |
Rabbit Polyclonal TLR4 Antibody
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody was developed against a sythetic peptide corresponding to amino acids 420-456 of human TLR4. |
USD 480.00
2 Weeks
Claudin 1 (CLDN1) (full length) mouse monoclonal antibody, clone 1C5-D9, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
CD14 mouse monoclonal antibody, clone B-A8, Purified
Applications | ELISA, FC, IHC |
Reactivities | Human |
Rabbit Polyclonal TLR5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TLR5 antibody was raised against a peptide corresponding to 16 amino acids near the center of human TLR5. |
Rabbit Polyclonal TLR4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the C-terminal portion of the human TLR4 protein (between residues 650-710) [UniProt O00206] |
Rabbit Polyclonal TLR5 Antibody
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine |
Conjugation | Unconjugated |
Immunogen | This antibody was developed against KLH-conjugated synthetic peptide corresponding to a portion of human TLR5 found between amino acids 300-350. It will cross-react with mouse and rat TLR5. |
Integrin beta 1 (ITGB1) mouse monoclonal antibody, clone B-D15, Azide Free
Applications | FC, IHC |
Reactivities | Human |
Integrin beta 1 (ITGB1) mouse monoclonal antibody, clone B-D15, Purified
Applications | FC, IHC |
Reactivities | Human |
TLR4 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Claudin 1 (CLDN1) (C-term) rabbit polyclonal antibody, Purified
Applications | IHC |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Immunogen | CLDN1 antibody was raised against a synthetic peptide derived from the C-terminus of human Claudin-1 |
Rabbit polyclonal anti-Claudin 1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Claudin 1. |
Rabbit Polyclonal E-cadherin Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human E-cadherin |
Rabbit Polyclonal Anti-CLDN1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLDN1 antibody: synthetic peptide directed towards the C terminal of human CLDN1. Synthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV |
Rabbit anti Claudin 1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide from C-terminus of human claudin 1 protein. |
Rabbit Polyclonal TLR4 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TLR4 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of human TLR4. |
Rabbit Polyclonal Anti-ITGB1 Antibody (Extracellular Domain)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ITGB1 / Integrin Beta 1 / CD29 antibody was raised against synthetic 17 amino acid peptide from extracellular domain of human Integrin Beta 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Dog, Bat, Panda, Horse (94%); Sheep, Bovine, Cat, Elephant, Pig (88%). |
Rabbit Polyclonal Anti-ITGB1 Antibody (Extracellular Domain)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ITGB1 / Integrin Beta 1 / CD29 antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human Integrin Beta 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Sheep, Dog, Bovine, Cat, Elephant, Panda, Horse, Pig (100%); Platypus (93%); Bat, Opossum (86%). |
Rabbit Polyclonal Anti-TLR4 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | TLR4 antibody was raised against synthetic 16 amino acid peptide from internal region of human TLR4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%); Baboon, Monkey (88%); Marmoset (81%). |
Carrier-free (BSA/glycerol-free) CDH1 mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CDH1 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CDH1 mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)
Applications | IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CDH1 mouse monoclonal antibody, clone OTI2F9 (formerly 2F9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CDH1 mouse monoclonal antibody,clone OTI4F1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CDH1 mouse monoclonal antibody,clone OTI1G1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CDH1 mouse monoclonal antibody,clone OTI1B11
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CDH1 mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD14 mouse monoclonal antibody,clone OTI10C2
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD14 mouse monoclonal antibody,clone OTI3F5
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD14 mouse monoclonal antibody,clone OTI12C8
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD14 mouse monoclonal antibody,clone OTI6D7
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD14 mouse monoclonal antibody,clone OTI9C7
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-CDH1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 773-787 amino acids of Human cadherin 1, type 1, E-cadherin (epithelial) |
Anti-pan CDH Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to C terminal 22 amino acids of human pan-cadherin |
Anti-pan CDH Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to C terminal 22 amino acids of human pan-cadherin |
Anti-CLDN1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 196-209 amino acids of Human claudin 1 |