Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Syndecan4 (Ab-179) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D). |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type V purified from Human and Bovine placenta |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
Rabbit anti-GP9 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GP9 |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
TMEM16A (ANO1) mouse monoclonal antibody, clone DOG1.1, Supernatant
| Applications | IHC |
| Reactivities | Human |
Rabbit Polyclonal Anti-COL1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS |
Collagen IV (COL4A1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Bovine, Human |
| Immunogen | Collagen Type IV from Human and Bovine placenta. |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Conjugation | Biotin |
| Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Rabbit Polyclonal antibody to Collagen III alpha1 (collagen, type III, alpha 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1247 and 1389 of Collagen III alpha1 |
Collagen I (COL1A1) (+ type III) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Human, Porcine |
| Immunogen | Porcine Collagen, types 1 and 3 from skin |
Von Willebrand Factor (VWF) goat polyclonal antibody, Purified
| Applications | ELISA, Ie, IHC |
| Reactivities | Human |
| Immunogen | Human von Willebrand Factor (vWF) purified from plasma |
Collagen V (COL5A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Conjugation | Biotin |
| Immunogen | Collagen Type V from Human and Bovine placenta. |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type V purified from Human and Bovine placenta |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal Collagen XI a2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Collagen XI a2. |
CDX2 rabbit monoclonal antibody, clone EPR2764Y, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Human |
Active filters
Applications
- IHC
Isotypes
- IgG
Pathways
- ECM-receptor interaction
Filter by
Category
Target Symbol
- COL1A1 (6)
- SPP1 (5)
- CD44 (4)
- COL4A1 (4)
- COL5A1 (4)
- COL6A1 (4)
- ITGB3 (4)
- VWF (4)
- COL3A1 (3)
- LAMB3 (3)
- THBS1 (3)
- TNXB (3)
- VTN (3)
- AGRN (2)
- CD36 (2)
- CD47 (2)
- COL1A2 (2)
- COL2A1 (2)
- COL5A2 (2)
- FN1 (2)
- HMMR (2)
- ITGA2B (2)
- ITGA3 (2)
- ITGA6 (2)
- ITGA7 (2)
- ITGAV (2)
- ITGB1 (2)
- ITGB4 (2)
- LAMA1 (2)
- LAMA3 (2)
- LAMA4 (2)
- LAMA5 (2)
- TNC (2)
- TNN (2)
- TNR (2)
- COL11A2 (1)
- COL4A2 (1)
- COL4A4 (1)
- COL4A6 (1)
- COL5A3 (1)
- COL6A2 (1)
- COL6A3 (1)
- COMP (1)
- GP1BA (1)
- GP6 (1)
- GP9 (1)
- HSPG2 (1)
- IBSP (1)
- ITGA11 (1)
- ITGA2 (1)
- ITGA4 (1)
- ITGB5 (1)
- ITGB6 (1)
- ITGB7 (1)
- LAMA2 (1)
- LAMB1 (1)
- LAMC3 (1)
- SDC1 (1)
- SDC4 (1)
- SV2A (1)
- THBS2 (1)