Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-TRIM32 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the C terminal of human TRIM32. Synthetic peptide located within the following region: GFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKE |
Rabbit polyclonal antibody to UBE4B (ubiquitination factor E4B (UFD2 homolog, yeast))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 869 and 1179 of UBE4B (Uniprot ID#O95155) |
Rabbit polyclonal ITCH (Tyr420) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ITCH around the phosphorylation site of tyrosine 420 (F-I-YP-G-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal BRCA1 (Ab-1423) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human BRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P). |
Rabbit polyclonal CDC16/APC6 (Ser560) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC16/APC6 around the phosphorylation site of serine 560 (I-I-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-APC1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human APC1. |
UBE1L2 / FLJ10808 Mouse Monoclonal (1D11) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-Cbl-c antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 444-458 of Human Cbl-c. |
Rabbit polyclonal Ubiquitin Activating Enzyme E1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-Ubiquitin Activating Enzyme E1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corresponding to full length Human Ubiquitin Activating Enzyme E1. |
Rabbit polyclonal SYVN1 (HRD1) Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SYVN1 (HRD1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 586-617 amino acids from the C-terminal region of human SYVN1 (HRD1). |
Rabbit polyclonal FBXW11 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FBXW11 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-196 amino acids from the Central region of human FBXW11. |
Rabbit Polyclonal Anti-PRPF19 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the middle region of human PRPF19. Synthetic peptide located within the following region: PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK |
Rabbit Polyclonal Anti-UBE2N Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-UBE2N Antibody: synthetic peptide directed towards the middle region of human UBE2N. Synthetic peptide located within the following region: GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE |
Rabbit Polyclonal Antibody against SAE1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SAE1 (AOS1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 300-329 amino acids from the C-terminal region of human SAE1 (AOS1). |
Rabbit Polyclonal Antibody against PIAS1 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PIAS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 100-130 amino acids from the N-terminal region of human PIAS1. |
Rabbit Polyclonal Antibody against PIAS1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PIAS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 607-637 amino acids from the C-terminal region of human PIAS1. |
Rabbit Polyclonal Antibody against UBE2S (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This E2EPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 192-222 amino acids from the C-terminal region of human E2EPF. |
Rabbit Polyclonal Antibody against UBE2S (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This E2EPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human E2EPF. |
Goat Anti-PIAS2 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KEAMKVSSQPCTKIE, from the internal region of the protein sequence according to NP_775298.1; NP_004662.2. |
Goat Anti-UBR5 / EDD1 Antibody
| Applications | IHC |
| Reactivities | Human, Rat, Mouse, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-LAIKTKNFGFV, from the C Terminus of the protein sequence according to NP_056986.2. |
Rabbit polyclonal APC1 phospho S377 antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 373-382 of Human Apc1 protein. |
| Modifications | Phospho-specific |
Rabbit polyclonal STUB1 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This STUB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 203-231 amino acids from the C-terminal region of human STUB1. |
Rabbit polyclonal UBE2L6 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This UBE2L6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 123-153 amino acids from the C-terminal region of human UBE2L6. |
Rabbit Polyclonal MDM2 (Ser166) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human MDM2 around the phosphorylation site of Sersine 166. |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-TCEB2 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCEB2 antibody: synthetic peptide directed towards the middle region of human TCEB2. Synthetic peptide located within the following region: TARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQ |
Rabbit Polyclonal anti-ERCC8 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the C terminal of human ERCC8. Synthetic peptide located within the following region: QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG |
Rabbit Polyclonal anti-EDG8 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EDG8 antibody: synthetic peptide directed towards the N terminal of human EDG8. Synthetic peptide located within the following region: MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI |
Rabbit Polyclonal Anti-WWP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WWP1 antibody: synthetic peptide directed towards the N terminal of human WWP1. Synthetic peptide located within the following region: ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT |
Rabbit Polyclonal Anti-WWP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WWP2 antibody: synthetic peptide directed towards the middle region of human WWP2. Synthetic peptide located within the following region: EMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYH |
Rabbit Polyclonal Anti-CDC20 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC20 antibody: synthetic peptide directed towards the N terminal of human CDC20. Synthetic peptide located within the following region: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSH |
Active filters
Reactivities
- Human
Applications
- IHC
Pathways
- Ubiquitin mediated proteolysis
Filter by
Category
Target Symbol
- UBE2G2 (50)
- MDM2 (45)
- UBE2J1 (30)
- FBXW7 (27)
- SOCS3 (27)
- ANAPC11 (25)
- SAE1 (22)
- UBE2E3 (20)
- BRCA1 (18)
- ERCC8 (16)
- UBE2D2 (16)
- KEAP1 (11)
- UBOX5 (10)
- CUL4B (7)
- SMURF2 (7)
- VHL (7)
- ANAPC2 (6)
- UBA2 (6)
- UBA3 (6)
- UBA7 (6)
- ANAPC1 (5)
- BIRC6 (5)
- PIAS1 (5)
- PIAS2 (5)
- UBE2D4 (5)
- UBE3B (5)
- BIRC2 (4)
- CDC16 (4)
- CUL3 (4)
- CUL4A (4)
- PRKN (4)
- SIAH1 (4)
- STUB1 (4)
- TRAF6 (4)
- UBE2L3 (4)
- UBE2S (4)
- AIRE (3)
- ANAPC10 (3)
- CDC20 (3)
- CUL1 (3)
- CUL7 (3)
- DDB1 (3)
- PIAS3 (3)
- PML (3)
- SOCS1 (3)
- TRIM32 (3)
- UBA1 (3)
- UBE2N (3)
- XIAP (3)
- ANAPC4 (2)
- ANAPC5 (2)
- CDC27 (2)
- CUL2 (2)
- CUL5 (2)
- PIAS4 (2)
- SKP1 (2)
- SYVN1 (2)
- UBR5 (2)
- ANAPC13 (1)
- ANAPC7 (1)
- BIRC3 (1)
- CBL (1)
- CBLC (1)
- CDC23 (1)
- CDC34 (1)
- ELOB (1)
- ELOC (1)
- FANCL (1)
- FBXO2 (1)
- FBXW11 (1)
- ITCH (1)
- KLHL13 (1)
- MAP3K1 (1)
- MID1 (1)
- NEDD4L (1)
- PRPF19 (1)
- RCHY1 (1)
- RHOBTB2 (1)
- RNF7 (1)
- SMURF1 (1)
- TTK (1)
- UBA6 (1)
- UBE2B (1)
- UBE2C (1)
- UBE2D1 (1)
- UBE2E1 (1)
- UBE2E2 (1)
- UBE2I (1)
- UBE2J2 (1)
- UBE2L6 (1)
- UBE2M (1)
- UBE4B (1)
- WWP1 (1)
- WWP2 (1)