Rabbit Polyclonal Anti-UBE2J2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2J2 antibody: synthetic peptide directed towards the C terminal of human UBE2J2. Synthetic peptide located within the following region: GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK |
Rabbit Polyclonal Anti-UBE2E2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2E2 antibody: synthetic peptide directed towards the N terminal of human UBE2E2. Synthetic peptide located within the following region: GDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLD |
Rabbit Polyclonal Anti-PIAS3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIAS3 antibody: synthetic peptide directed towards the C terminal of human PIAS3. Synthetic peptide located within the following region: TSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIV |
Rabbit Polyclonal Anti-PML Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PML Antibody: synthetic peptide directed towards the C terminal of human PML. Synthetic peptide located within the following region: EGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFR |
Rabbit Polyclonal Anti-UBE2N Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2N antibody: synthetic peptide directed towards the middle region of human UBE2N. Synthetic peptide located within the following region: VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW |
Rabbit Polyclonal Anti-SIAH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIAH1 antibody: synthetic peptide directed towards the N terminal of human SIAH1. Synthetic peptide located within the following region: FTCLPAARTRKRKEMSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLA |
Rabbit Polyclonal Anti-SIAH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SIAH1 Antibody: synthetic peptide directed towards the C terminal of human SIAH1. Synthetic peptide located within the following region: LVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP |
Rabbit Polyclonal Anti-FANCL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FANCL Antibody: synthetic peptide directed towards the middle region of human FANCL. Synthetic peptide located within the following region: ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY |
Rabbit Polyclonal TRAF-6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 451-469 (DAKPELLAFQRPTIPRNPK) of human TRAF6 was used as immunogen, GenBank no. NP_665802.1. |
Rabbit Polyclonal XIAP Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant BIR2 domain protein fragment of human XIAP was used as immunogen. The BIR2 domain used for immunogen corresponds to amino acids 163-230 of human XIAP (Deveraux et al, 1999). |
Rabbit Polyclonal Anti-KLHL13 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLHL13 antibody: synthetic peptide directed towards the N terminal of human KLHL13. Synthetic peptide located within the following region: KTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKLSLGGSEMGLS |
Rabbit Polyclonal Anti-KEAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KEAP1 antibody: synthetic peptide directed towards the N terminal of human KEAP1. Synthetic peptide located within the following region: SQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNEL |
Rabbit Polyclonal Anti-KEAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KEAP1 antibody: synthetic peptide directed towards the C terminal of human KEAP1. Synthetic peptide located within the following region: TWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWS |
Rabbit Polyclonal Anti-UBA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBA3 antibody: synthetic peptide directed towards the N terminal of human UBA3. Synthetic peptide located within the following region: EGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCEL |
Rabbit Polyclonal Anti-Pias2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pias2 antibody: synthetic peptide directed towards the C terminal of mouse Pias2. Synthetic peptide located within the following region: LSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSE |
Rabbit Polyclonal Anti-CUL3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CUL3 antibody: synthetic peptide directed towards the C terminal of human CUL3. Synthetic peptide located within the following region: QETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTS |
Rabbit anti-BRCA1 (Phospho-Ser1524) polyclonal antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1524 (Y-P-SP-Q-E). |
| Modifications | Phospho-specific |
Rabbit anti-BRCA1 (Phospho-Ser1423) polyclonal antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-Cullin 3 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human Cullin 3. |
Rabbit polyclonal APC1(Ser355) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human APC1 around the phosphorylation site of serine 355 (A-H-SP-P-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-Cul4A antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1-20 of Human Cul4A (N-terminus) coupled to KLH. |
Rabbit polyclonal anti-Cul5 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 4-18 of Human Cul5 (N-terminus) coupled to KLH. |
Rabbit polyclonal anti-Cul3 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1-12 of Human Cul3 (N-terminus) coupled to KLH. |
Rabbit polyclonal anti-Cul1 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 766-776 of Human Cul1 (C-terminus) coupled to KLH. |
Rabbit polyclonal anti-Cul7 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1679-1698 of Human Cul7 (C-terminus) coupled to KLH. |
Rabbit polyclonal anti-Cul2 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 733-745 of Human Cul2 (C-terminus) coupled to KLH. |
Rabbit Polyclonal BRUCE Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | BRUCE antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human BRUCE. |
Phospho-BRCA1-S1524 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S1524 of human BRCA1 |
| Modifications | Phospho-specific |
Carrier-free (BSA/glycerol-free) KEAP1 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
