Germany
Japan
United Kingdom
China
USD 379.00
In Stock
Antibodies
View as table Download
USD 379.00
In Stock
Mouse Monoclonal iNOS Antibody (4E5)
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
TA336918 is a replacement of AM06772PU-N.
GLUD1 Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Pig |
| Conjugation | Unconjugated |
| Immunogen | GLUD1/Glutamate Dehydrogenase antibody was raised against synthetic peptide C-ESEEQKRNRVRGILR from an internal region of human GLUD1 (NP_005262.1; NP_036216.2). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Panda, Horse, Pig (100%); Rat, Opossum, Pufferfish (93%); Bovine, Xenopus, Stickleback (87%). |
Rabbit polyclonal GLS Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GLS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 516-545 amino acids from the C-terminal region of human GLS. |
Rabbit polyclonal OAT Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This OAT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-55 amino acids from the N-terminal region of human OAT. |
Rabbit Polyclonal Antibody against ALDH2 (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2. |
Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%). |
Rabbit Polyclonal antibody to Creatine kinase (brain) (creatine kinase, brain)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 165 and 381 of Creatine kinase (brain) (Uniprot ID#P12277) |
Rabbit polyclonal OTC Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This OTC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-98 amino acids from the Central region of human OTC. |
Rabbit polyclonal Inos (Tyr151) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Inos around the phosphorylation site of tyrosine 151 (Q-Y-YP-G-S). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MAOB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV |
Rabbit anti eNOS Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the internal sequence (residing in 550-650aa) of human eNOS protein. This sequence is identical among human, rat, mouse, bovine origins. |
Rabbit anti iNOS Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-term of Mouse iNOS protein. |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Active filters
Reactivities
- Mouse
Applications
- IHC
Pathways
- Arginine and proline metabolism
Filter by
Category
Target Symbol
- OTC (117)
- ACY1 (33)
- PYCR2 (20)
- SMS (20)
- ASS1 (15)
- GLUL (13)
- CPS1 (12)
- GLS2 (12)
- ASL (11)
- ALDH7A1 (10)
- GATM (10)
- MAOA (10)
- ARG1 (9)
- ALDH4A1 (7)
- P4HA3 (5)
- PYCR1 (5)
- SAT2 (5)
- AMD1 (4)
- NOS2 (4)
- MAOB (3)
- ALDH2 (2)
- ALDH9A1 (2)
- CKM (2)
- GLS (2)
- GOT1 (2)
- CKB (1)
- CKMT1B (1)
- CKMT2 (1)
- GLUD1 (1)
- GOT2 (1)
- NOS3 (1)
- OAT (1)
- ODC1 (1)