Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 134 results

Page 1 of 3

(reset)

CD13 (ANPEP) Rabbit Monoclonal Antibody [Clone ID: EPR4058]

TA307568

USD 520.00

In Stock

Rabbit monoclonal antibody against CD13(clone EPR4058)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

GST3 (GSTP1) Rabbit Polyclonal Antibody

TA332845

USD 275.00

3 Weeks

Rabbit anti-GSTP1 Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant protein of human GSTP1

1 / 3

2 / 3

3 / 3

Previous Next

RRM1 Rabbit Polyclonal Antibody

TA326954

USD 275.00

3 Weeks

RRM1 Rabbit Polyclonal Antibody

Applications	ICC/IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human RRM1

1 / 2

2 / 2

Previous Next

Glutathione S Transferase theta 1 (GSTT1) Rabbit Polyclonal Antibody

TA327030

USD 275.00

In Stock

GSTT1 Rabbit Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human GSTT1

p53R2 (RRM2B) Rabbit Polyclonal Antibody

TA306062

USD 430.00

5 Days

Rabbit Polyclonal p53R2 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	p53R2 antibody was raised against a synthetic peptide corresponding to amino acids 2 to 17 of human p53R2 .

1 / 3

2 / 3

3 / 3

Previous Next

GST3 (GSTP1) Rabbit Polyclonal Antibody

TA306508

USD 430.00

5 Days

Rabbit Polyclonal GSTP1 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	GSTP1 antibody was raised against a 14 amino acid peptide from near the center of human GSTP1.

1 / 3

2 / 3

3 / 3

Previous Next

CD13 (ANPEP) Rabbit Polyclonal Antibody

TA332824

USD 275.00

3 Weeks

Rabbit anti-ANPEP Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human ANPEP

GGT1 Rabbit Polyclonal Antibody

TA327174

USD 275.00

3 Weeks

GGT1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human GGT1

Glutathione Peroxidase 4 (GPX4) Goat Polyclonal Antibody

TA303125

USD 375.00

5 Days

Goat Polyclonal Antibody against GPX4

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-EEPLVIEKDLPHY, from the C Terminus of the protein sequence according to NP_002076.2; NP_001034937.1.

1 / 2

2 / 2

Previous Next

IDH2 Rabbit Polyclonal Antibody

TA319664

USD 430.00

2 Weeks

Rabbit Polyclonal IDH2 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	IDH2 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human IDH2.

1 / 3

2 / 3

3 / 3

Previous Next

GCLM Rabbit Polyclonal Antibody

TA325093

USD 450.00

5 Days

Rabbit polyclonal GCLM Antibody (C-term)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	This GCLM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 246-274 amino acids from the C-terminal region of human GCLM.

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PGD Rabbit Polyclonal Antibody

TA308104

USD 415.00

5 Days

Rabbit Polyclonal antibody to PGD (phosphogluconate dehydrogenase)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 201 of PGD (Uniprot ID#P52209)

1 / 3

2 / 3

3 / 3

Previous Next

MGST3 Rabbit Polyclonal Antibody

TA314194

USD 345.00

In Stock

Rabbit polyclonal anti-MGST3 antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human MGST3.

GSTM1 Rabbit Polyclonal Antibody

TA324877

USD 450.00

5 Days

Rabbit polyclonal GSTM1 Antibody (C-term)

Applications	FC, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	This GSTM1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 184-211 amino acids from the C-terminal region of human GSTM1.

1 / 3

2 / 3

3 / 3

Previous Next

RRM2 Rabbit Polyclonal Antibody

TA327571

USD 345.00

3 Weeks

RRM2 Rabbit Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human RRM2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

IDH2 Rabbit Polyclonal Antibody

TA336931

USD 424.00

5 Days

Rabbit Polyclonal IDH2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to a C-terminal portion of the human IDH2 protein (between residues 375-452) [UniProt P48735].

1 / 3

2 / 3

3 / 3

Previous Next

GGT1 Rabbit Polyclonal Antibody

TA308190

USD 415.00

5 Days

Rabbit Polyclonal antibody to GGT1 (gamma-glutamyltransferase 1)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 226 of GGT1 (Uniprot ID#P19440)

1 / 3

2 / 3

3 / 3

Previous Next

GCLM Rabbit Polyclonal Antibody

TA335034

USD 375.00

5 Days

Rabbit Polyclonal Anti-GCLM Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-GCLM antibody: synthetic peptide directed towards the middle region of human GCLM. Synthetic peptide located within the following region: KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ

1 / 3

2 / 3

3 / 3

Previous Next

Glutathione Synthetase (GSS) Mouse Monoclonal Antibody [Clone ID: OTI1A12]

CF501932

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSS mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Glutathione Synthetase (GSS) Mouse Monoclonal Antibody [Clone ID: OTI1B8]

CF502094

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSS mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI2G8]

CF503091

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI3A8]

CF503097

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI5F2]

CF503098

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI5F2 (formerly 5F2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI3C9]

CF503099

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

PGD Mouse Monoclonal Antibody [Clone ID: OTI2A5]

CF505578

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PGD mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

GCLC Mouse Monoclonal Antibody [Clone ID: OTI1A3]

CF507318

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) GCLC mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Isocitrate dehydrogenase (IDH1) Mouse Monoclonal Antibody [Clone ID: OTI3G9]

CF800406

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) IDH1 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Isocitrate dehydrogenase (IDH1) Mouse Monoclonal Antibody [Clone ID: OTI24A2]

CF800426

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) IDH1 mouse monoclonal antibody, clone OTI24A2 (formerly 24A2)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Isocitrate dehydrogenase (IDH1) Mouse Monoclonal Antibody [Clone ID: OTI1D1]

CF800427

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) IDH1 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

RRM1 Mouse Monoclonal Antibody [Clone ID: OTI5G5]

CF801208

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RRM1 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GST3 (GSTP1) Mouse Monoclonal Antibody [Clone ID: OTI4B6]

CF801775

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GSTP1 mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

GST3 (GSTP1) Mouse Monoclonal Antibody [Clone ID: OTI10H1]

CF801776

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GSTP1 mouse monoclonal antibody, clone OTI10H1 (formerly 10H1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

RRM1 Mouse Monoclonal Antibody [Clone ID: OTI6G8]

CF804382

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RRM1 mouse monoclonal antibody,clone OTI6G8

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

RRM1 Mouse Monoclonal Antibody [Clone ID: OTI1F9]

CF804454

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RRM1 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

RRM1 Mouse Monoclonal Antibody [Clone ID: OTI16A8]

CF804537

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) RRM1 mouse monoclonal antibody, clone OTI16A8 (formerly 16A8)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

RRM1 Mouse Monoclonal Antibody [Clone ID: OTI17C3]

CF804723

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RRM1 mouse monoclonal antibody, clone OTI17C3 (formerly 17C3)

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

RRM1 Mouse Monoclonal Antibody [Clone ID: OTI2D10]

CF804875

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RRM1 mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

RRM2 Mouse Monoclonal Antibody [Clone ID: OTI3D3]

CF810467

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RRM2 mouse monoclonal antibody,clone OTI3D3

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

RRM2 Mouse Monoclonal Antibody [Clone ID: OTI1F2]

CF810548

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RRM2 mouse monoclonal antibody,clone OTI1F2

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Ornithine Decarboxylase (ODC1) Rabbit Polyclonal Antibody

TA321500

USD 345.00

In Stock

Anti-ODC1 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 300 amino acids of human ornithine decarboxylase 1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

RRM1 Rabbit Polyclonal Antibody

TA323395

USD 345.00

In Stock

Anti-RRM1 Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 226 amino acids of human ribonucleotide reductase M1

Glutathione Reductase (GSR) Rabbit Polyclonal Antibody

TA323576

USD 345.00

In Stock

Anti-GSR Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 274-475 amino acids of human glutathione reductase

Glutathione Reductase (GSR) Rabbit Polyclonal Antibody

TA323577

USD 345.00

In Stock

Anti-GSR Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 274-475 amino acids of human glutathione reductase

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Isocitrate dehydrogenase (IDH1) Rabbit Polyclonal Antibody

TA349598

USD 345.00

In Stock

Rabbit Polyclonal Anti-IDH1 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human IDH1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GST3 (GSTP1) Rabbit Polyclonal Antibody

TA350040

USD 345.00

In Stock

Rabbit Polyclonal Anti-GSTP1 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human GSTP1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

IDH2 Rabbit Polyclonal Antibody

TA350076

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-IDH2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human IDH2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

CD13 (ANPEP) Rabbit Polyclonal Antibody

TA350805

USD 345.00

In Stock

Rabbit Polyclonal Anti-ANPEP Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human ANPEP

Glutathione Synthetase (GSS) Mouse Monoclonal Antibody [Clone ID: OTI1A12]

TA501932

USD 379.00

In Stock

GSS (Glutathione Synthetase) mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Glutathione Synthetase (GSS) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A12]

TA501932AM

USD 420.00

4 Weeks

GSS (Glutathione Synthetase) mouse monoclonal antibody, clone OTI1A12 (formerly 1A12), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

Glutathione Synthetase (GSS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A12]

TA501932BM

USD 420.00

4 Weeks

GSS (Glutathione Synthetase) mouse monoclonal antibody, clone OTI1A12 (formerly 1A12), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

1 - 50 of 134 results

Page 1 of 3