Rabbit anti-ADH5 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ADH5 |
Rabbit anti-ADH5 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ADH5 |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal Anti-DLD Antibody - middle region
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
HK1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HK1 |
Rabbit anti-ALDH2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH2 |
Rabbit Polyclonal Anti-GAPDH Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GAPDH |
PKM2 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant Protein of human PKM2 |
Rabbit anti-ENO1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ENO1 |
Rabbit anti-AKR1A1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AKR1A1 |
Rabbit anti-PDHA1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDHA1 |
Rabbit Monoclonal Antibody against LDHA (Clone EP1563Y)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-HK2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HK2 |
Rabbit Polyclonal GAPDH Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GAPDH antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human GAPDH. |
Rabbit Polyclonal Aldolase B Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal antibody to PFKL (phosphofructokinase, liver)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 428 and 674 of PFKL (Uniprot ID#P17858) |
Rabbit Polyclonal PCK1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Antibody against ALDH2 (Center)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2. |
Rabbit polyclonal anti-PDHA1 antibody
Applications | IHC, WB |
Reactivities | Human Mouse Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PDHA1. |
Rabbit polyclonal ENO1 Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit polyclonal ADH1B Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ADH1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-237 amino acids from the Central region of human ADH1B. |
Rabbit polyclonal GAPDH Antibody (C-term R248)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This GAPDH antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 233-259 amino acids from the C-terminal region of human GAPDH. |
Rabbit anti-LDHA Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LDHA |
Anti-ADH1B Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 226-338 amino acids of human alcohol dehydrogenase 1B (class I), beta polypeptide |
Rabbit polyclonal Pyruvate Kinase (PKM2) Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This Pyruvate Kinase (PKM2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-505 amino acids from the C-terminal region of human Pyruvate Kinase (PKM2). |
Rabbit polyclonal Aldolase (ALDOA) Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Aldolase (ALDOA) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 66-95 amino acids from the N-terminal region of human Aldolase (ALDOA). |
Rabbit Polyclonal Anti-ENO1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK |
Rabbit Polyclonal GAPDH/G3PDH Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | The epitope recognized by this antibody maps to a region between residues 150 and 200 of human GAPDH using the numbering given in entry NP_002037.2 (GeneID 2597). |
Goat Polyclonal Antibody against Aldehyde Reductase
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DAGHPLYPFNDPY, from the C Terminus of the protein sequence according to NP_006057.1; NP_697021.1. |
Rabbit polyclonal HK2 (Hexokinase II) Antibody (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-121 amino acids from the N-terminal region of human HK2 (Hexokinase II). |
Goat Anti-PCK1 / PEPCKC (internal) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HVNWFRKDKEGK, from the internal region of the protein sequence according to NP_002582.3. |
Carrier-free (BSA/glycerol-free) GCK mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKR1A1 mouse monoclonal antibody, clone OTI9F1 (formerly 9F1)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKR1A1 mouse monoclonal antibody, clone OTI8E12 (formerly 8E12)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKR1A1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKR1A1 mouse monoclonal antibody, clone OTI8H2 (formerly 8H2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKR1A1 mouse monoclonal antibody, clone OTI10E11 (formerly 10E11)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKR1A1 mouse monoclonal antibody, clone OTI6E3 (formerly 6E3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKR1A1 mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKR1A1 mouse monoclonal antibody, clone OTI3C7 (formerly 3C7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKR1A1 mouse monoclonal antibody, clone OTI4G6 (formerly 4G6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI8G7 (formerly 8G7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI7G10 (formerly 7G10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1A3 mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1A3 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1A3 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |