Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal HDAC2 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HDAC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 410-439 amino acids from the Central region of human HDAC2. |
Rabbit polyclonal anti-Jagged 1 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This protein A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 110-125 of human Jagged-1protein. |
HDAC2 Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HDAC2 |
Rabbit Polyclonal HDAC2 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal CtBP1 (Ab-422) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CtBP1 around the phosphorylation site of serine 422 (A-P-SP-P-G). |
Rabbit polyclonal CtBP1 (Ser422) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CtBP1 around the phosphorylation site of serine 422 (A-P-SP-P-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-DELTA-4 antibody
| Applications | IHC, WB |
| Reactivities | Human, partial reactivity to Mouse and Rat |
| Conjugation | Unconjugated |
| Immunogen | Anti-DELTA-4 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human DELTA-4. |
Rabbit polyclonal RBPJL Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RBPJL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 8-36 amino acids from the N-terminal region of human RBPJL. |
Rabbit polyclonal DVL1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This DVL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 442-470 amino acids from the Central region of human DVL1. |
Rabbit polyclonal antibody to RBP-Jkappa (recombination signal binding protein for immunoglobulin kappa J region)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 258 and 500 of RBP-Jkappa (Uniprot ID#Q06330) |
Rabbit polyclonal anti-HDAC-1 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-HDAC-1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 466-482 of Human HDAC-1. |
Rabbit polyclonal anti-NOTCH 2 antibody
| Applications | IHC, WB |
| Reactivities | Chimpanzee, Human, Dog |
| Conjugation | Unconjugated |
| Immunogen | This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues 2396-2409 of human Notch 2 (the total protein is 2471 aa). A residue of cysteine was added to the amino terminal end to facilitate coupling. |
Anti-HDAC2 (Phospho-Ser394) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 394 (E-D-S(p)-G-D) derived from Human HDAC2. |
| Modifications | Phospho-specific |
Rabbit polyclonal DVL3 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This DVL3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 530-557 amino acids from the C-terminal region of human DVL3. |
Rabbit polyclonal RBPJ Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RBPJ antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-29 amino acids from the N-terminal region of human RBPJ. |
Rabbit Polyclonal anti-RBPSUH antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBPSUH antibody: synthetic peptide directed towards the C terminal of human RBPSUH. Synthetic peptide located within the following region: RPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS |
Rabbit Polyclonal Anti-HDAC2 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN |
Rabbit Polyclonal Anti-HDAC2 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN |
Rabbit anti-HDAC2 (Phospho-Ser394) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanHDAC2 around the phosphorylation site of serine 394 (E-D-SP-G-D). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-NOTCH 2 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues of human Notch 2 located near the N-terminal sequence of the cleaved N intracellular domain (NICD). |
Rabbit Polyclonal Anti-DVL2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DVL2 antibody: synthetic peptide directed towards the N terminal of human DVL2. Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA |
Active filters
Reactivities
- Human
Applications
- IHC
Pathways
- Notch signaling pathway
Filter by
Category
Target Symbol
- NUMB (31)
- HES1 (24)
- NOTCH1 (22)
- DVL2 (17)
- HDAC2 (17)
- CTBP2 (10)
- JAG1 (9)
- HDAC1 (6)
- CTBP1 (5)
- NOTCH2 (4)
- RBPJ (4)
- CREBBP (3)
- DTX1 (3)
- EP300 (3)
- HES5 (3)
- NCSTN (3)
- PSEN1 (3)
- APH1A (2)
- DLL4 (2)
- JAG2 (2)
- NOTCH3 (2)
- ADAM17 (1)
- DLL3 (1)
- DTX2 (1)
- DTX3 (1)
- DVL1 (1)
- DVL3 (1)
- NCOR2 (1)
- NOTCH4 (1)
- PSEN2 (1)
- PSENEN (1)
- RBPJL (1)
- SNW1 (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (137)
- ES Cell Differentiation/IPS (82)
- Transcription Factors (59)
- Stem cell relevant signaling - DSL/Notch pathway (55)
- Adult stem cells (52)
- Cancer stem cells (49)
- Stem cell - Pluripotency (33)
- Transmembrane (29)
- Stem cell relevant signaling - Wnt Signaling pathway (10)
- Protease (5)