Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal HIF1A Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A. |
Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Dog, Bovine, Bat, Hamster, Elephant, Panda, Horse, Rabbit (94%); Rat, Pig, Opossum (88%). |
GNAT3 / Gustducin Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | GNAT3 / Gustducin antibody was raised against synthetic peptide C-KNQFLDLNLKKEDKE from an internal region of human GNAT3 (NP_001095856.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum (100%); Bat, Lizard (93%); Platypus (87%); Turkey, Chicken (80%). |
FSP1 / S100A4 Goat Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Horse, Human, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | S100A4 / FSP1 antibody was raised against synthetic peptide CNEFFEGFPDKQP from the C-terminus of human S100A4 / FSP1 (NP_002952.1; NP_062427.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Marmoset, Hamster, Elephant, Bat (92%); Mouse, Rat (85%). |
Rabbit Polyclonal Calnexin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the rat Calnexin protein (between residues 550-591) [UniProt P35565] |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
TRPV2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Horse, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Horse, Pig (100%); Gibbon, Bovine, Hamster, Panda, Rabbit (93%); Mouse, Dog (87%); Elephant (80%). |
NOS1 (1419-1433) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Hamster, Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 425.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
Optineurin Rabbit Polyclonal (aa575-591) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | OPTN / Optineurin antibody was raised against synthetic peptide corresponding to aa 559-575 (GEVLPDIDTLQIHVMDC) of human, mouse and rat optineurin |
HRH1 / H1 Receptor Goat Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Chimpanzee, Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | HRH1 / Histamine H1 Receptor antibody was raised against synthetic peptide CNENFKKTFKRILH from the C-terminus of human HRH1 / Histamine H1 Receptor (NP_000852.1; NP_001091681.1; NP_001091682.1; NP_001091683.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Bat, Platypus (100%); Monkey, Mouse, Rat, Dog, Bovine, Hamster, Elephant, Panda, Rabbit, Horse, Pig, Turkey, Chicken (93%); Marmoset, Guinea pig, Xenopus (86%). |
Rabbit polyclonal Vimentin Antibody (S82)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Vimentin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 63-90 amino acids from human Vimentin. |
Rabbit polyclonal HSP90B1 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HSP90B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 16-43 amino acids from the N-terminal region of human HSP90B1. |
Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Goat, Hamster, Rabbit, Primate |
| Conjugation | Unconjugated |
| Immunogen | A fusion protein including residues 530-825 of the mouse HIF-1 alpha protein. [UniProt# Q61221] |
Mouse Monoclonal HP1-gamma Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Hamster, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal HP1-gamma Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Hamster, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Rabbit Polyclonal Antibody against DRP1
| Applications | IHC |
| Reactivities | Human, Primate, Mouse, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region within residues 500-600 of the human protein. [Swiss-Prot# O00429] |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
Anti-Hepsin Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Human, Monkey, Orang-Utan, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | HPN / TMPRSS1 / Hepsin antibody was raised against human hepsin amino acids 241-260 (GGYLPFRDPNSEENSNDIAL). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Bovine, Dog, Bat, Panda, Rabbit (100%); Opossum (95%); Hamster, Horse (90%); Mouse, Rat (85%); Xenopus (80%). |
Anti-IGFBP-5 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Goat, Hamster, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | IGFBP5 antibody was raised against human IGFBP5 amino acids 192-206 (CRRHMEASLQELKAS). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Bat, Bovine, Goat, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Mouse, Rat, Opossum, Chicken (93%); Marmoset (87%). |
INPP5J / PIB5PA Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | INPP5J / PIB5PA antibody was raised against synthetic 18 amino acid peptide from near C-terminus of human INPP5J / PIB5PA. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Platypus (83%). |
PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | PGES / PTGES antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Rabbit, Pig (100%); Hamster, Bovine (94%); Dog, Horse, Turkey, Chicken (88%); Pike (81%). |
ZIP14 / SLC39A14 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Chimpanzee, Dog, Gorilla, Horse, Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | SLC39A14 / ZIP14 antibody was raised against synthetic 15 amino acid peptide from internal region of human SLC39A14. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Panda, Dog, Bat, Horse, Pig (100%); Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Hamster, Bovine (93%); Elephant (87%); Rat, Rabbit, Guinea pig (80%). |
ZIP14 / SLC39A14 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan, Pig |
| Conjugation | Unconjugated |
| Immunogen | SLC39A14 / ZIP14 antibody was raised against synthetic 15 amino acid peptide from cytoplasmic domain of human SLC39A14. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Pig (100%); Bovine, Dog, Hamster, Elephant, Panda (93%); Rat, Bat, Rabbit, Horse, Opossum (87%); Mouse (80%). |
WNT2B Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%). |
Aspartate Aminotransferase Goat Polyclonal (aa157-167) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Hamster, Human, Orang-Utan, Rat |
| Conjugation | Unconjugated |
| Immunogen | Aspartate Aminotransferase antibody was raised against synthetic peptide C-RSYRYWDAEKR from an internal region of human GOT1 (NP_002070.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Hamster, Elephant (100%); Marmoset, Goat, Pig, Lizard (91%); Mouse, Panda, Bat, Bovine, Horse, Opossum, Turkey, Chicken, Platypus, Xenopus, Salmon, Pufferfish, Seq squirt (82%). |
SLC22A17 Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat |
| Conjugation | Unconjugated |
| Immunogen | SLC22A17 antibody was raised against synthetic peptide C-PETKRKLLPEVLRD from an internal region of human SLC22A17 (NP_065105.2; NP_057693.3). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Bat, Bovine, Horse, Pig (100%); Elephant, Rabbit (93%). |
UCP2 Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Xenopus, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | UCP2 antibody was raised against synthetic peptide C-DSVKQFYTKGSEH from an internal region of human UCP2 (NP_003346.2). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Bovine, Dog, Horse, Rabbit, Pig, Opossum, Xenopus, Stickleback (100%); Smelt, Zebrafish (92%); Trout, Salmon (85%). |
SCG10 / STMN2 Goat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bovine, Chicken, Dog, Hamster, Horse, Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | SCG10 / STMN2 antibody was raised against synthetic peptide AKTAMAYKEK-C from the N-terminus of human STMN2 (NP_008960.2). Percent identity by BLAST analysis: Human, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Turkey, Chicken (100%); Xenopus, Stickleback, Zebrafish (90%); Water flea, Poplar, Arabidopsis (80%). |
Anti-ROR1 Goat Polyclonal () Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | ROR1 antibody was raised against synthetic peptide C-GNKSQKPYKIDSKQA from the C-terminus (near) of human ROR1 (NP_005003.2). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Lizard (93%); Turkey, Chicken (87%); Platypus (80%). |
DOK3 Goat Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DOK3 antibody was raised against synthetic peptide TRERRKGPAPCDRP from the C-terminus of human DOK3 (NP_079148.2). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Rabbit (93%); Bovine, Bat (86%). |
Rabbit polyclonal COPE Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This COPE antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-300 amino acids from the C-terminal region of human COPE. |
Rabbit polyclonal PCYT1A Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PCYT1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-54 amino acids from the N-terminal region of human PCYT1A. |
Rabbit polyclonal TSN Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TSN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 109-138 amino acids from the Central region of human TSN. |
Rabbit polyclonal Vimentin Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Vimentin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 430-457 amino acids from the C-terminal region of human Vimentin. |
Rabbit polyclonal PCNA Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
Rabbit Polyclonal HSP60 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 300-360). [Swiss-Prot P10809] |
Rabbit Polyclonal Anti-KCNQ1 Antibody
| Applications | IHC, WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI |
Rabbit Polyclonal anti-UBB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | Native bovine Ubiquitin, conjugated to KLH |
Active filters
Reactivities
- Hamster
Applications
- IHC
Filter by
Category
Target Symbol
- HSPD1 (5)
- GLG1 (3)
- VIM (3)
- ADRA1B (2)
- CANX (2)
- CXCR5 (2)
- DRD3 (2)
- ERP44 (2)
- GPC4 (2)
- HIF1A (2)
- HP1 GAMMA (2)
- HSPA8 (2)
- KCNJ6 (2)
- KCNMA1 (2)
- NR2E3 (2)
- SLC39A14 (2)
- SNAP25 (2)
- SYNTAXIN (2)
- WNT10A (2)
- WNT4 (2)
- ABCG1 (1)
- ACKR4 (1)
- ACTA1 (1)
- ACTB (1)
- ADAMTS5 (1)
- ADGRA2 (1)
- ADGRF5 (1)
- AGR2 (1)
- AGTR2 (1)
- AKT1 (1)
- BEST2 (1)
- CADM2 (1)
- CALCRL (1)
- CD8A (1)
- CDK2 (1)
- CELSR3 (1)
- CHRM3 (1)
- CNR2 (1)
- COPE (1)
- COX4I1 (1)
- CTNNB1 (1)
- DDR1 (1)
- DNM1L (1)
- DOK3 (1)
- DPP10 (1)
- DPP9 (1)
- EPHB2 (1)
- ESRRB (1)
- FASN (1)
- FAU (1)
- FKBP4 (1)
- GHRHR (1)
- GNAT3 (1)
- GOT1 (1)
- GPR137B (1)
- GPR139 (1)
- GPR173 (1)
- GPR183 (1)
- GPR19 (1)
- GPR3 (1)
- GPR55 (1)
- GPR61 (1)
- GPR88 (1)
- GPRC6A (1)
- GRM1 (1)
- GRM2 (1)
- GRM4 (1)
- GRPR (1)
- GSK3B (1)
- HCAR1 (1)
- HK2 (1)
- HMGB1 (1)
- HPN (1)
- HRH1 (1)
- HRH3 (1)
- HSP90B1 (1)
- HSPA1A (1)
- HTR1F (1)
- HTR4 (1)
- HTR6 (1)
- IGFBP5 (1)
- ITGA3 (1)
- KCNH2 (1)
- KCNQ1 (1)
- KCNQ2 (1)
- KDR (1)
- KRT10 (1)
- KRT7 (1)
- LGR5 (1)
- LPAR4 (1)
- LPP (1)
- MAP2K1 (1)
- MAP3K8 (1)
- MC3R (1)
- MELTF (1)
- MLEC (1)
- MMP13 (1)
- MSN (1)
- NMBR (1)
- NPC1 (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- Phospho-specific (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
Assay Types
Families
- Druggable Genome (121)
- Transmembrane (100)
- GPCR (35)
- Secreted Protein (15)
- Transcription Factors (12)
- Stem cell - Pluripotency (11)
- Protein Kinase (8)
- ES Cell Differentiation/IPS (7)
- Ion Channels: Potassium (7)
- Protease (6)
- Nuclear Hormone Receptor (3)
- Adult stem cells (2)
- Cancer stem cells (2)
- Ion Channels: Transient receptor potential (2)
- Stem cell relevant signaling - Wnt Signaling pathway (2)
- Phosphatase (1)
Pathways
- Neuroactive ligand-receptor interaction (23)
- Pathways in cancer (17)
- Basal cell carcinoma (12)
- Melanogenesis (12)
- Wnt signaling pathway (12)
- Hedgehog signaling pathway (11)
- Calcium signaling pathway (9)
- MAPK signaling pathway (6)
- Metabolic pathways (6)
- Vascular smooth muscle contraction (6)
- RNA degradation (5)
- Type I diabetes mellitus (5)
- Antigen processing and presentation (4)
- Cell adhesion molecules (CAMs) (4)
- Endocytosis (4)
- Focal adhesion (4)
- Regulation of actin cytoskeleton (4)
- Chemokine signaling pathway (3)
- Cytokine-cytokine receptor interaction (3)
- Gap junction (3)
- Huntington's disease (3)
- Prion diseases (3)
- Prostate cancer (3)
- Renal cell carcinoma (3)
- Taste transduction (3)
- Adherens junction (2)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (2)
- Base excision repair (2)
- Bladder cancer (2)
- Cell cycle (2)
- Chronic myeloid leukemia (2)
- Colorectal cancer (2)
- Dilated cardiomyopathy (2)
- Endometrial cancer (2)
- Fc gamma R-mediated phagocytosis (2)
- Glioma (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- Insulin signaling pathway (2)
- Long-term depression (2)
- Long-term potentiation (2)
- Lysosome (2)
- Melanoma (2)
- Neurotrophin signaling pathway (2)
- Non-small cell lung cancer (2)
- Nucleotide excision repair (2)
- Olfactory transduction (2)
- Pancreatic cancer (2)
- Parkinson's disease (2)
- Pathogenic Escherichia coli infection (2)
- Progesterone-mediated oocyte maturation (2)
- Small cell lung cancer (2)
- Spliceosome (2)
- T cell receptor signaling pathway (2)
- Thyroid cancer (2)
- Toll-like receptor signaling pathway (2)
- VEGF signaling pathway (2)
- Vibrio cholerae infection (2)
- mTOR signaling pathway (2)
- ABC transporters (1)
- Acute myeloid leukemia (1)
- Alanine (1)
- Alzheimer's disease (1)
- Amyotrophic lateral sclerosis (ALS) (1)
- Apoptosis (1)
- Arachidonic acid metabolism (1)
- Arginine and proline metabolism (1)
- Axon guidance (1)
- B cell receptor signaling pathway (1)
- Cardiac muscle contraction (1)
- Cysteine and methionine metabolism (1)
- DNA replication (1)
- Dorso-ventral axis formation (1)
- ECM-receptor interaction (1)
- ErbB signaling pathway (1)
- Fatty acid biosynthesis (1)
- Fc epsilon RI signaling pathway (1)
- Glycerophospholipid metabolism (1)
- GnRH signaling pathway (1)
- Hematopoietic cell lineage (1)
- Inositol phosphate metabolism (1)
- Leukocyte transendothelial migration (1)
- Mismatch repair (1)
- NOD-like receptor signaling pathway (1)
- Natural killer cell mediated cytotoxicity (1)
- Oocyte meiosis (1)
- Oxidative phosphorylation (1)
- Phenylalanine (1)
- Phenylalanine metabolism (1)
- Phosphatidylinositol signaling system (1)
- Purine metabolism (1)
- Renin-angiotensin system (1)
- Ribosome (1)
- Tight junction (1)
- Tyrosine metabolism (1)
- Viral myocarditis (1)
- aspartate and glutamate metabolism (1)
- p53 signaling pathway (1)
- tyrosine and tryptophan biosynthesis (1)