Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal p21 Cip1 (Thr145) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p21 Cip1 around the phosphorylation site of Threonine 145 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CREB3L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREB3L1 antibody: synthetic peptide directed towards the N terminal of human CREB3L1. Synthetic peptide located within the following region: MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFTENMEDF |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB around the phosphorylation site of Sersine 133. |
| Modifications | Phospho-specific |
Phospho-IGF1R-Y1161 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1161 of human IGF1R |
| Modifications | Phospho-specific |
Rabbit monoclonal antibody against Rb (clone EP44(2) )
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TCF7L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Rabbit Polyclonal Anti-HSP90AA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HSP90AA1 |
Rabbit Polyclonal Anti-NFKB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NFKB1 |
Rabbit Polyclonal Anti-CREB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CREB1 |
Rabbit Polyclonal Anti-RB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RB1 |
Goat Polyclonal Antibody against ATF4
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EEVRKARGKKRVP, from the C Terminus of the protein sequence according to NP_001666. |
Rabbit monoclonal antibody against PI3-kinase p110 subunit delta(clone EPR386)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Cyclin E1 (Ab-395) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-T-P-P). |
Rabbit polyclonal PDGFR beta (Ab-1021) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PDGFR β around the phosphorylation site of tyrosine 1021 (N-D-YP-I-I). |
Rabbit polyclonal HSP90B (Ab-254) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
Rabbit polyclonal Raf1 (Ab-621) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P). |
Rabbit polyclonal Akt (Ab-129) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A). |
Rabbit polyclonal Akt (Ab-326) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R). |
Rabbit polyclonal NFkB p65 phospho S536 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding S536 of human p65 (RelA) protein. |
Rabbit Polyclonal Akt (Thr308) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Akt around the phosphorylation site of Threonine 308 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Caspase 9 (Thr125) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 9 around the phosphorylation site of Threonine 125 |
| Modifications | Phospho-specific |
Rabbit Polyclonal NF- kappaB p65 (Ser536) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p65 around the phosphorylation site of Serine 536 |
| Modifications | Phospho-specific |
Rabbit polyclonal ATF-4 (Phospho-Ser219) antibody
| Applications | WB |
| Reactivities | H:S219, M:S218 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ATF-4. |
| Modifications | Phospho-specific |
Rabbit polyclonal B-RAF (Phospho-Ser446) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human B-RAF around the phosphorylation site of serine 446 (R-D-SP-S-D). |
| Modifications | Phospho-specific |
Active filters
Category
- Antibodies
Applications
- WB
Isotypes
- IgG
Pathways
- Prostate cancer
Availabilities
- In Stock
Filter by
Target Symbol
- EGFR (18)
- AKT1 (16)
- TP53 (15)
- RELA (11)
- ERBB2 (9)
- PDGFRB (9)
- BRAF (8)
- CHUK (8)
- CREB1 (8)
- CTNNB1 (8)
- FGFR1 (8)
- FOXO1 (8)
- IKBKG (8)
- NFKB1 (8)
- RAF1 (8)
- CDK2 (7)
- MAP2K1 (7)
- MAPK3 (7)
- IGF1R (6)
- NFKBIA (6)
- RB1 (6)
- BAD (5)
- CASP9 (5)
- CCNE1 (5)
- CDKN1A (5)
- MDM2 (5)
- MTOR (5)
- CCND1 (4)
- CDKN1B (4)
- IKBKB (4)
- PTEN (4)
- AKT2 (3)
- ATF4 (3)
- BCL2 (3)
- HSP90AA1 (3)
- HSP90AB1 (3)
- MAP2K2 (3)
- MAPK1 (3)
- AR (2)
- E2F1 (2)
- E2F2 (2)
- EP300 (2)
- HRAS (2)
- HSP90B1 (2)
- INS (2)
- NRAS (2)
- PDGFRA (2)
- PDPK1 (2)
- PIK3CD (2)
- PIK3R3 (2)
- ARAF (1)
- CREB3L1 (1)
- CREB3L2 (1)
- CREBBP (1)
- EGF (1)
- FGFR2 (1)
- GRB2 (1)
- GSTP1 (1)
- PDGFB (1)
- PIK3CG (1)
- PIK3R2 (1)
- SOS2 (1)
- TCF7 (1)
- TCF7L1 (1)
- TCF7L2 (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (289)
- Protein Kinase (135)
- Transcription Factors (102)
- ES Cell Differentiation/IPS (71)
- Transmembrane (57)
- Stem cell - Pluripotency (35)
- Stem cell relevant signaling - JAK/STAT signaling pathway (22)
- Secreted Protein (21)
- Adult stem cells (19)
- Cancer stem cells (18)
- Stem cell relevant signaling - DSL/Notch pathway (9)
- Protease (5)
- Phosphatase (4)
- Stem cell relevant signaling - Wnt Signaling pathway (4)
- Nuclear Hormone Receptor (2)
- Embryonic stem cells (1)
- Induced pluripotent stem cells (1)