Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
N-cadherin Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human N-cadherin |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against DKK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SOX9 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ |
Rabbit Polyclonal Anti-ABCG2(CD338) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABCG2(CD338) Antibody: Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338). |
Goat Polyclonal Anti-CD31 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 690 aa to the C-terminus of human CD31 produced in E. coli. |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal PECAM-1 (Tyr713) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
| Modifications | Phospho-specific |
Rabbit Polyclonal STAT5A (Ser780) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT5A around the phosphorylation site of Serine 780 |
| Modifications | Phospho-specific |
Rabbit Polyclonal STAT5A/B (Ser725/730) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT5A/B around the phosphorylation site of Serine 725/730 |
| Modifications | Phospho-specific |
USD 375.00
5 Days
Rabbit Polyclonal Anti-G6pc Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6pc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI |
Active filters
Category
- Antibodies
Applications
- WB
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- ES Cell Differentiation/IPS
Citations
- Yes
Filter by
Target Symbol
- GAPDH (7)
- PECAM1 (3)
- ABCG2 (2)
- ACTB (2)
- CDH2 (2)
- CTNNB1 (2)
- G6PC (2)
- KDR (2)
- MAPK8 (2)
- SLC2A1 (2)
- STAT5A (2)
- AKT1 (1)
- ANPEP (1)
- BST2 (1)
- CASP3 (1)
- CD4 (1)
- CD44 (1)
- CD81 (1)
- CDH5 (1)
- CYP3A4 (1)
- CYP7A1 (1)
- DKK1 (1)
- EGFR (1)
- FGF21 (1)
- GATA3 (1)
- GLI1 (1)
- GREM1 (1)
- HCRTR1 (1)
- HNF4A (1)
- ITGA2B (1)
- ITGA4 (1)
- JMJD6 (1)
- LAMP1 (1)
- LAMP2 (1)
- MAPK3 (1)
- NEUROD1 (1)
- NOTCH1 (1)
- PRNP (1)
- PROM1 (1)
- SMAD3 (1)
- SOX2 (1)
- SOX9 (1)
- TNFRSF8 (1)
- TUBB3 (1)
- WNT2 (1)
Reactivities
Antibody Hosts
Clonalities
Modifications
Pathways
- Pathways in cancer (17)
- Focal adhesion (13)
- Metabolic pathways (12)
- Alzheimer's disease (9)
- Colorectal cancer (9)
- Glycolysis / Gluconeogenesis (9)
- Leukocyte transendothelial migration (9)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (8)
- Cell adhesion molecules (CAMs) (8)
- Adherens junction (7)
- Adipocytokine signaling pathway (7)
- ErbB signaling pathway (7)
- MAPK signaling pathway (7)
- Regulation of actin cytoskeleton (7)
- Wnt signaling pathway (7)
- Insulin signaling pathway (6)
- Pancreatic cancer (6)
- Chronic myeloid leukemia (5)
- Endometrial cancer (5)
- Hematopoietic cell lineage (5)
- Pathogenic Escherichia coli infection (5)
- Prostate cancer (5)
- Tight junction (5)
- Acute myeloid leukemia (4)
- Basal cell carcinoma (4)
- Cytokine-cytokine receptor interaction (4)
- Dilated cardiomyopathy (4)
- Epithelial cell signaling in Helicobacter pylori infection (4)
- Fc epsilon RI signaling pathway (4)
- GnRH signaling pathway (4)
- Hypertrophic cardiomyopathy (HCM) (4)
- Melanogenesis (4)
- Melanoma (4)
- Neurotrophin signaling pathway (4)
- Progesterone-mediated oocyte maturation (4)
- Renal cell carcinoma (4)
- Toll-like receptor signaling pathway (4)
- VEGF signaling pathway (4)
- B cell receptor signaling pathway (3)
- Dorso-ventral axis formation (3)
- ECM-receptor interaction (3)
- Endocytosis (3)
- Gap junction (3)
- Glioma (3)
- Jak-STAT signaling pathway (3)
- NOD-like receptor signaling pathway (3)
- Non-small cell lung cancer (3)
- Prion diseases (3)
- T cell receptor signaling pathway (3)
- Thyroid cancer (3)
- Type II diabetes mellitus (3)
- Viral myocarditis (3)
- ABC transporters (2)
- Apoptosis (2)
- Bladder cancer (2)
- Chemokine signaling pathway (2)
- Fc gamma R-mediated phagocytosis (2)
- Galactose metabolism (2)
- Hedgehog signaling pathway (2)
- Lysosome (2)
- Maturity onset diabetes of the young (2)
- Natural killer cell mediated cytotoxicity (2)
- RIG-I-like receptor signaling pathway (2)
- Small cell lung cancer (2)
- Starch and sucrose metabolism (2)
- TGF-beta signaling pathway (2)
- Vibrio cholerae infection (2)
- mTOR signaling pathway (2)
- Amyotrophic lateral sclerosis (ALS) (1)
- Antigen processing and presentation (1)
- Axon guidance (1)
- Calcium signaling pathway (1)
- Cell cycle (1)
- Drug metabolism - cytochrome P450 (1)
- Drug metabolism - other enzymes (1)
- Glutathione metabolism (1)
- Huntington's disease (1)
- Linoleic acid metabolism (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Metabolism of xenobiotics by cytochrome P450 (1)
- Neuroactive ligand-receptor interaction (1)
- Notch signaling pathway (1)
- Oocyte meiosis (1)
- PPAR signaling pathway (1)
- Parkinson's disease (1)
- Primary bile acid biosynthesis (1)
- Primary immunodeficiency (1)
- Renin-angiotensin system (1)
- Retinol metabolism (1)
- Vascular smooth muscle contraction (1)
- p53 signaling pathway (1)