Goat Polyclonal Anti-tdTomato Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-tdTomato Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-mCherry Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-ZO1 Antibody
Applications | IF, IHC, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli. |
Goat Anti-Rabbit IgG Secondary Antibody
Applications | WB, IHC, IF/ICC, ELISA |
Reactivities | Rabbit IgG |
Conjugation | Unconjugated |
Immunogen | Rabbit IgG, whole molecule |
Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Goat Polyclonal Anti-GFP Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-mCherry Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-mCherry Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-GFP Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Anti-Mouse IgG Secondary Antibody
Applications | WB, IHC, IF/ICC, ELISA |
Reactivities | Mouse IgG |
Conjugation | Unconjugated |
Immunogen | Mouse IgG, whole molecule |
Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH |
Rabbit Polyclonal RNAse H2A Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RNAse H2A antibody was raised against a 17 amino acid peptide near the center of human RNAse H2A. |
Rabbit polyclonal anti-ABCC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC3. |
Rabbit Polyclonal Antibody against LC3B
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the N-terminal region of the human LC3, isoform B protein. |
Goat Polyclonal Anti-CANX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli. |
Rabbit Anti-Mouse IgG Secondary Antibody
Applications | WB, IHC, IF/ICC, ELISA |
Reactivities | Mouse IgG |
Conjugation | Unconjugated |
Immunogen | Mouse IgG, whole molecule |
Goat Polyclonal Anti-mCherry Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-RFP Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant RFP peptide produced in E. coli. |
Goat Polyclonal Anti-CD63 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli. |
ABCC4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
Goat Polyclonal Antibody against ABCC4
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2. |
Goat Polyclonal Anti-GFP Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Goat Polyclonal Anti-GFP Antibody
Applications | IF, WB |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide produced in E. coli. |
Rabbit polyclonal anti-ABCC2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC2. |
Rabbit Polyclonal Anti-NOX4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NOX4 antibody was raised against a 14 amino acid peptide near the amino terminus of human NOX4. |
Goat Anti-GATA3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence EVTADQPRWVSHH-C, from the N Terminus of the protein sequence according to NP_001002295.1; NP_002042.1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Rabbit Polyclonal Dact2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Dact2 antibody was raised against a 12 amino acid peptide from near the amino terminus of human DACT2. |
Rabbit polyclonal SLC11A2 Antibody (Center)
Applications | IF, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
Rabbit Polyclonal Anti-LILRB2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LILRB2 |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Rabbit anti-BRCA1 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P). |
Rabbit Polyclonal OCLN Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Goat Polyclonal Anti-CANX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli. |
Rabbit anti-ZEB1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ZEB1 |
Rabbit Polyclonal H3K9/14ac Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Antibody against Eg5
Applications | WB |
Reactivities | Human, Mouse, Bovine, Goat, Hamster, Sheep |
Conjugation | Unconjugated |
Immunogen | Produced by immunization of rabbits with a recombinant segment of the coiled-coil domain of the human protein. |
Rabbit anti-ADH5 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ADH5 |
Goat Polyclonal Anti-CX43 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli. |
Rabbit Polyclonal Antibody against LC3
Applications | IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 50-150). |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal Nephrin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Goat Polyclonal Anti-Rab27a Antibody
Applications | IHC, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a produced in E. coli. |
Rabbit Polyclonal RHBDD2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RHBDD2 antibody was raised against an 18 amino acid peptide from near the center of human RHBDD2. |
Rabbit Polyclonal FOXP3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
PPP4C Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP4C |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |