Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Goat Anti-GATA3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence EVTADQPRWVSHH-C, from the N Terminus of the protein sequence according to NP_001002295.1; NP_002042.1. |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Antibody against GLUT1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of the human GLUT1 protein (between residues 1-100). [Swiss-Prot #P11166] |
Rabbit anti-LAMP1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LAMP1 |
Rabbit Monoclonal antibody against CD317 / BST2
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
Applications | Dot, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
Modifications | Phospho-specific |
Rabbit Monoclonal antibody against Gli-1 (GLI1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal EGFR (Ab-1172) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
Modifications | Phospho-specific |
Rabbit Monoclonal Antibody against CASP3 (Clone E87)
Applications | FC, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Monoclonal Antibody against NOTCH1 (Clone EP1238Y)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Cow |
Conjugation | Unconjugated |
USD 524.00
In Stock
Rabbit Monoclonal Antibody against PRNP (Clone EP1802Y)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against CD13(clone EPR4058)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
Modifications | Phospho-specific |
CD133 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human CD133 |
Goat Polyclonal Anti-beta-Catenin Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli. |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
Modifications | Phospho-specific |
N-cadherin Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human N-cadherin |
Goat Polyclonal Antibody against HCRTR1
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-YNFLSGKFREQFK, from the internal region of the protein sequence according to NP_001516.1; NP_001517.1. |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
Modifications | Phospho-specific |
DLL4 rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to the internal region of human DLL4. |
Goat Polyclonal Antibody against DKK1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Rabbit Polyclonal Beta-actin Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | b-actin antibody was raised against a 16 amino acid peptide from near the carboxy-terminus of human b-actin. |
Rabbit Polyclonal Integrin alpha 4 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Integrin alpha 4 antibody was raised against a 15 amino acid peptide from near the center of human Integrin alpha 4. |
Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt |
Modifications | Phospho-specific |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
Modifications | Phospho-specific |
Goat Polyclonal Anti-CD4 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
Rabbit Polyclonal JMJD6 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | JMJD6 antibody was raised against a 15 amino acid peptide from near the amino terminus of human JMJD6. |
Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P). |
Modifications | Phospho-specific |
Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SOX9 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ |
Rabbit Polyclonal Anti-ABCG2(CD338) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ABCG2(CD338) Antibody: Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338). |
Rabbit Polyclonal CD30 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Goat Polyclonal Anti-CD31 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 690 aa to the C-terminus of human CD31 produced in E. coli. |
Goat Polyclonal Antibody against FGF21
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CQRPDGALYGSLH, from the internal region of the protein sequence according to NP_061986.1. |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit polyclonal anti-GLUT1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human GLUT1. |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
Modifications | Phospho-specific |
Rabbit Polyclonal N Cadherin Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit polyclonal PECAM-1 (Tyr713) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Modifications | Phospho-specific |
Rabbit Polyclonal STAT5A (Ser780) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT5A around the phosphorylation site of Serine 780 |
Modifications | Phospho-specific |