Rabbit anti-PRKCA Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human PRKCA |
Rabbit anti-PRKCA Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human PRKCA |
Rabbit Polyclonal Anti-PROM1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PROM1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human PROM1. |
Phospho-PRKCB-T641 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T641 of human PRKCB |
Modifications | Phospho-specific |
PLCB1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PLCB1 |
PLCG2 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PLCG2 |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal Anti-PRRX1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PRRX1 antibody was raised against a 19 amino acid peptide near the center of human PRRX1. |
Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E). |
Modifications | Phospho-specific |
Rabbit anti-PRKCB Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRKCB |
Rabbit Polyclonal Anti-Ippk Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Ippk antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VFYQKLLDLSTEDDGTVAFALTKVQQYRVAMTAKDCSIMIALSPCLQGTS |
Rabbit Polyclonal Anti-PI3 kinase P110a Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PI3 kinase P110a Antibody: A synthesized peptide derived from human PI3 kinase P110a |
Rabbit Polyclonal Antibody against VPS34
Applications | WB |
Reactivities | Human, Rat, Mouse, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human protein (within residues 700-850). [Swiss-Prot# Q8NEB9] |
Rabbit polyclonal PLCG1 (Ab-771) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PLCG1 around the phosphorylation site of tyrosine 771 (P-D-Y-G-A). |
Rabbit polyclonal PTEN (Ab-370) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of serine 370. |
Rabbit polyclonal anti-ITPKB antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human ITPKB. |
Rabbit polyclonal anti-PLCB2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human PLCB2. |
Anti-PLCG2 (Phospho-Tyr753) Rabbit Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of tyrosine 753 (S-L-Y(p)-D-V) derived from Human PLC?2. |
Modifications | Phospho-specific |
Anti-PTEN (Phospho-Ser380/Thr382/Thr383) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of threonine 380/382/383 (R-Y-S(p)-D-T(p)-T(p)-D-S) derived from Human PTEN. |
Modifications | Phospho-specific |
Rabbit polyclonal PI3KC3 Antibody (S34)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PI3KC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 14-39 amino acids from human PI3KC3. |
Rabbit Polyclonal PI3-kinase p85- alpha/ gamma (Tyr467/199) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha/ gamma around the phosphorylation site of Tyrosine 467/199 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-IMPA2 Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Impa2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Impa2. Synthetic peptide located within the following region: GAFCNGQRLQVSRETDLAKALVLTEIGPKRDPDTLKVFLSNMERLLHAKA |
Rabbit Polyclonal Anti-SHIP1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHIP1 Antibody: A synthesized peptide derived from human SHIP1 |
Rabbit Polyclonal Anti-ITPK1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ITPK1 Antibody: A synthesized peptide derived from human ITPK1 |
Rabbit Polyclonal Anti-PI3-kinase p85-alpha Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PI3-kinase p85-alpha Antibody: A synthesized peptide derived from human PI3-kinase p85-alpha |
Rabbit Polyclonal Anti-INPP4B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | INPP4B antibody was raised against a 17 amino acid peptide near the amino terminus of human INPP4B. |
Rabbit Polyclonal Antibody against PIK3R1 (Y580)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PIK3R1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 558-587 amino acids from human PIK3R1. |
Rabbit polyclonal antibody to INPP1 (inositol polyphosphate-1-phosphatase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 3 and 269 of INPP1 (Uniprot ID#P49441) |
Rabbit Polyclonal antibody to PI3 kinase p110 beta (phosphoinositide-3-kinase, catalytic, beta polypeptide)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 509 and 820 of PI3 kinase p110 beta (Uniprot ID#P42338) |
Rabbit polyclonal PKC a (Ab-657) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKC a around the phosphorylation site of tyrosine 657 (F-S-YP-V-N). |
Rabbit polyclonal anti-DGKB antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKB. |
Rabbit polyclonal anti-PRKCG antibody
Applications | WB |
Reactivities | Human Mouse Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PRKCG. |
Rabbit polyclonal anti-DGKE antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKE. |
Rabbit polyclonal anti-PIP5K antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PIP5K. |
Anti-PRKCB (Phospho-Thr641) Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of threonine 641 (E-L-T(p)-P-T) derived from Human PKCβ |
Modifications | Phospho-specific |
Rabbit polyclonal PI3KCD Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PI3KCD antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 85-114 amino acids from the N-terminal region of human PI3KCD. |
Rabbit polyclonal PI3-kinase p85-a (Phospho-Tyr607) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PI3-kinase p85-α around the phosphorylation site of tyrosine 607 (D-Q-YP-S-L). |
Modifications | Phospho-specific |
Rabbit polyclonal PRKCG (Ab-655) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PRKCG around the phosphorylation site of threonine 655 (A-L-TP-P-P). |
Rabbit Polyclonal Phospho-PKCB (Ser661) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PKCB around the phosphorylation site of Serine 661 |
Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PKC alpha (Thr638) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC alpha around the phosphorylation site of Threonine 638 |
Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PKC-pan (Thr497) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC-pan around the phosphorylation site of Threonine 497 |
Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PLCG1 (Tyr771) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 around the phosphorylation site of Tyrosine 771 |
Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PLCG1 (Tyr783) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 around the phosphorylation site of Tyrosine 783 |
Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PTEN (Ser370) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN around the phosphorylation site of Serine 370 |
Modifications | Phospho-specific |
Rabbit Polyclonal PKCB Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PKCB |
Rabbit Polyclonal PLCG2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG2 |
Rabbit Polyclonal PKC alpha Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC alpha |
Rabbit Polyclonal PKC-pan Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC-pan |
Rabbit Polyclonal PLCG1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 |
Rabbit Polyclonal PLCG1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 |