Antibodies

View as table Download

Mouse Monoclonal COX IV Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Goat, Hamster, Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal VMAT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human VMAT2 protein (within residues 30-200). [Swiss-Prot Q05940]

Rabbit Polyclonal Anti-TRPC1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide QLYDKGYTSKEQKDC, corresponding to amino acid residues 557-571 of human TRPC1.Intracellular.

Rabbit Polyclonal Anti-UCRC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Goat Anti-SLC6A3 / DAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QLTSSTLTNPRQSP, from the internal region (near N Terminus) of the protein sequence according to NP_001035.1.

Rabbit polyclonal anti-NDUFA4L2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2.

Rabbit polyclonal anti-COX IV antibody, Loading control

Applications IHC, WB
Reactivities Human, Mouse, Bovine, Primate, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073]

Rabbit anti-SLC25A4 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SLC25A4

Rabbit anti-HTRA2 Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HTRA2

Rabbit Polyclonal OMI Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen OMI antibody was raised against a peptide corresponding to 16 amino acids near the C-terminus of human Omi.

Rabbit polyclonal anti-COX6C antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human COX6C.

Rabbit polyclonal anti-GPR37 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR37.

Rabbit polyclonal anti-NDUFA4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDUFA4.

Rabbit polyclonal anti-COX42 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human COX42.

Rabbit polyclonal SLC25A31 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SLC25A31 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 139-167 amino acids from the Central region of human SLC25A31.

Rabbit polyclonal SLC25A6 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SLC25A6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-155 amino acids from the Central region of human SLC25A6.

Rabbit polyclonal COX41 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human COX41.

Rabbit Polyclonal Anti-SLC25A6 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC25A6 antibody: synthetic peptide directed towards the N terminal of human SLC25A6. Synthetic peptide located within the following region: LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ

Rabbit Polyclonal Anti-SLC18A1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC18A1 antibody is: synthetic peptide directed towards the N-terminal region of Human SLC18A1. Synthetic peptide located within the following region: FKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWM

Rabbit Polyclonal Anti-ATP5G2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP5G2 antibody: synthetic peptide directed towards the N terminal of human ATP5G2. Synthetic peptide located within the following region: SRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTA

Rabbit Polyclonal Anti-COX42 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COX42 Antibody: A synthesized peptide derived from human COX42

Rabbit Polyclonal Anti-COX6C Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COX6C Antibody: A synthesized peptide derived from human COX6C

Rabbit Polyclonal Anti-COX IV antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COX IV antibody: A synthesized peptide derived from human COX IV

Rabbit Polyclonal OMI Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen OMI antibody was raised against a peptide corresponding to 15 amino acids near the C-terminus of human OMI.

Rabbit Polyclonal antibody to NDUFB5 (NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 126 and 189 of NDUFB5 (Uniprot ID#O43674)

Rabbit Polyclonal antibody to COX4 (cytochrome c oxidase subunit IV isoform 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 169 of COX4 (Uniprot ID#P13073)

Rabbit Anti-Dopamine Transporter, C-Terminus, Human Antibody

Applications WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the intracellular C-terminal region conjugated to KLH

Rabbit Anti-Dopamine Transporter, Extracellular Loop 2, Human Antibody

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the extracellular loop 2 region conjugated to KLH

Rabbit polyclonal anti-SLC25A6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SLC25A6.

Rabbit polyclonal anti-SLC25A31 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SLC25A31.

Rabbit polyclonal Pael-R (GPR37) Antibody (N-term)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This Pael-R (GPR37) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-126 amino acids from the N-terminal region of human Pael-R (GPR37).

Rabbit Polyclonal Anti-UBE2J2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBE2J2 antibody: synthetic peptide directed towards the C terminal of human UBE2J2. Synthetic peptide located within the following region: GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK

Rabbit Polyclonal Anti-SLC18A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC18A2 Antibody: synthetic peptide directed towards the N terminal of human SLC18A2. Synthetic peptide located within the following region: NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT

Rabbit Polyclonal Anti-SLC25A4 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC25A4 Antibody: synthetic peptide directed towards the N terminal of human SLC25A4. Synthetic peptide located within the following region: LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT

Rabbit Polyclonal Anti-SLC6A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC6A3 Antibody: synthetic peptide directed towards the N terminal of human SLC6A3. Synthetic peptide located within the following region: HCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSH

Rabbit Polyclonal Anti-SLC18A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC18A1 antibody: synthetic peptide directed towards the middle region of human SLC18A1. Synthetic peptide located within the following region: YYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE

Goat Polyclonal Antibody against COX4I1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QGLASKWDYEKNE, from the C Terminus of the protein sequence according to NP_001852.1.

Rabbit polyclonal antibody to ATP synthase C1(mitochondrial) (ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 82 of ATP5G1 (Uniprot ID#P05496)

Goat Anti-COX4I2 & COX4I1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RWDYEKKQWKK, from the C Terminus of the protein sequence according to NP_115998.2.

Rabbit polyclonal anti-UBE2J1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues near the amino terminus of the human Ube2j1 protein.

Rabbit polyclonal Ubiquitin-Conjugating Enzyme E2 J2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of the human Ube2j2 protein.

Rabbit polyclonal anti-NDUA4 antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NDUA4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 56-80 amino acids from the C-terminal region of human NDUA4.

Rabbit Polyclonal Anti-COX7A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-COX7A2 antibody is: synthetic peptide directed towards the middle region of Human COX7A2. Synthetic peptide located within the following region: ASRRHFKNKVPEKQKLFQEDDEIPLYLKGGVADALLYRATMILTVGGTAY

Rabbit Polyclonal Anti-COX7A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-COX7A2 antibody is: synthetic peptide directed towards the C-terminal region of Human COX7A2. Synthetic peptide located within the following region: LFQEDDEIPLYLKGGVADALLYRATMILTVGGTAYAIYELAVASFPKKQE

Rabbit Polyclonal Anti-NDUFB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NDUFB4 Antibody is: synthetic peptide directed towards the C-terminal region of Human NDUFB4. Synthetic peptide located within the following region: ARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGK

Rabbit Polyclonal Anti-SLC25A31 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC25A31 Antibody: synthetic peptide directed towards the N terminal of human SLC25A31. Synthetic peptide located within the following region: LAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRIP

Rabbit Polyclonal Anti-GPR37 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR37 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR37. Synthetic peptide located within the following region: KIRKAEKACTRGNKRQIQLESQMNCTVVALTILYGFCIIPENICNIVTAY

Rabbit Polyclonal Anti-SLC18A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC18A1 antibody: synthetic peptide directed towards the N terminal of human SLC18A1. Synthetic peptide located within the following region: MNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITRVGVLFASKAVMQLL

Rabbit Polyclonal Anti-NDUFC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDUFC2 antibody: synthetic peptide directed towards the N terminal of human NDUFC2. Synthetic peptide located within the following region: IARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRP