Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-PSMA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the C terminal of human PSMA1. Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL |
Rabbit Polyclonal Anti-PSMA3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA3 antibody: synthetic peptide directed towards the middle region of human PSMA3. Synthetic peptide located within the following region: VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN |
Rabbit Polyclonal Anti-PSMC4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMC4 antibody: synthetic peptide directed towards the N terminal of human PSMC4. Synthetic peptide located within the following region: MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE |
Rabbit anti-PSMC3 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSMC3 |
Rabbit anti-PSMA1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSMA1 |
Rabbit anti-PSMB4 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSMB4 |
Rabbit Polyclonal Anti-PSMA3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA3 antibody: synthetic peptide directed towards the middle region of human PSMA3. Synthetic peptide located within the following region: TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE |
Rabbit Polyclonal Anti-PSMC4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMC4 antibody: synthetic peptide directed towards the N terminal of human PSMC4. Synthetic peptide located within the following region: MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE |
Rabbit Polyclonal Anti-PSMA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the N terminal of human PSMA1. Synthetic peptide located within the following region: MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALK |
Rabbit Polyclonal Anti-PSMD2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD2 Antibody: A synthesized peptide derived from human PSMD2 |
Rabbit Polyclonal Anti-PSMD2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD2 Antibody: A synthesized peptide derived from human PSMD2 |
Rabbit Polyclonal Anti-Interferon gamma Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interferon gamma Antibody: A synthesized peptide derived from human Interferon gamma |
Rabbit polyclonal antibody to PSMC3 (proteasome (prosome, macropain) 26S subunit, ATPase, 3)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 51 and 361 of PSMC3 (Uniprot ID#P17980) |
Rabbit Polyclonal antibody to Proteasome 20S alpha 2 (proteasome (prosome, macropain) subunit, alpha type, 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 234 of Proteasome 20S alpha 2 (Uniprot ID#P25787) |
Rabbit polyclonal antibody to PSMB8 (proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 52 and 276 of PSMB8 (Uniprot ID#P28062) |
Rabbit Polyclonal antibody to Proteasome 20S alpha 6 (proteasome (prosome, macropain) subunit, alpha type, 6)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 57 and 246 of Proteasome 20S alpha 6 |
Rabbit Polyclonal antibody to Proteasome 20S alpha 7 (proteasome (prosome, macropain) subunit, alpha type, 7)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 205 of Proteasome 20S alpha 7 (Uniprot ID#O14818) |
Rabbit polyclonal anti-PSMD2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human PSMD2 |
Anti-PSMD2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 2 |
Rabbit Polyclonal Anti-PSMD14 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD14 antibody: synthetic peptide directed towards the N terminal of human PSMD14. Synthetic peptide located within the following region: MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVP |
Rabbit Polyclonal Anti-PSMC5 Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PSMC5 Antibody: synthetic peptide directed towards the C terminal of human PSMC5. Synthetic peptide located within the following region: AEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK |
Interferon gamma (IFNG) mouse monoclonal antibody, clone GC8
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone GF1
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone G-23, Aff - Purified
| Applications | FC, WB |
| Reactivities | Human |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 165, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 3F1E3, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
PSMC3 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog |
| Immunogen | The immunogen for anti-PSMC3 antibody: synthetic peptide directed towards the middle region of human PSMC3. |
Interferon gamma (IFNG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly purified recombinant Inferferon gamma. |
Rabbit polyclonal antibody to 20S Proteasome alpha3 (proteasome (prosome, macropain) subunit, alpha type, 3)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 137 of Proteasome 20S alpha 3 |
Rabbit Polyclonal antibody to Proteasome 20S alpha 6 (proteasome (prosome, macropain) subunit, alpha type, 6)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 234 of Proteasome 20S alpha 6 (Uniprot ID#P60900) |
Rabbit Polyclonal antibody to Proteasome 20S alpha 7 (proteasome (prosome, macropain) subunit, alpha type, 7)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 10 and 247 of Proteasome 20S alpha 7 (Uniprot ID#O14818) |
Rabbit Polyclonal Anti-PSMD7 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Psmd7 antibody is: synthetic peptide directed towards the C-terminal region of Rat Psmd7. Synthetic peptide located within the following region: LIRSVVALHNLINNKIANRDAEKKEGQEKEESKKERKDDKEKEKSDAKKE |
PSMD7 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human PSMD7 |
Active filters
Applications
- WB
Families
- Druggable Genome
Pathways
- Proteasome