Germany
Japan
United Kingdom
China
Antibodies
View as table Download
IKBKB Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human IKBKB |
Rabbit anti-PDX1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human PDX1 |
Mouse Monoclonal IKKβ Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
Rabbit polyclonal antibody to IKK beta (inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 493 and 739 of IKK beta (Uniprot ID#O14920) |
Rabbit Polyclonal IKK-beta Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK-beta |
Rabbit Polyclonal IKK- beta (Tyr188) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK- beta around the phosphorylation site of Tyrosine 188 |
| Modifications | Phospho-specific |
Rabbit Polyclonal IKK- beta (Tyr199) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK- beta around the phosphorylation site of Tyrosine 199 |
| Modifications | Phospho-specific |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal IKK beta Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IKK beta antibody was raised against a peptide corresponding to amino acids near the carboxy-terminus of human IKK beta (Genbank accession NoO14920), which differs from corresponding murine sequence by one amino acid. |
Rabbit polyclonal IPF Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from the C-terminal region of human IPF. |
Rabbit Polyclonal Anti-PDX1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDX1 antibody: synthetic peptide directed towards the N terminal of human PDX1. Synthetic peptide located within the following region: MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPF |
Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDX1 mouse monoclonal antibody, clone OTI7F7 (formerly 7F7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-PDX1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 18-31 amino acids of human pancreatic and duodenal homeobox 1 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Applications
- WB
Families
- Transcription Factors
Pathways
- Type II diabetes mellitus