Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit polyclonal HIF1A Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A. |
Rabbit Polyclonal Antibody against SAT1
| Applications | WB |
| Reactivities | Human, Mouse, Porcine, Xenopus, Hamster, Cow, Rat, Chicken |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal region within residues 100-171 of the human protein. [Swiss-Prot# P21673] |
Rabbit polyclonal DDIT3 Antibody (C-term A135)
| Applications | FC, IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DDIT3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 120-149 amino acids from the C-terminal region of human DDIT3. |
Rabbit polyclonal Vimentin Antibody (S82)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Vimentin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 63-90 amino acids from human Vimentin. |
Rabbit polyclonal anti-HSPD1(HSP60) antibody(Center), Loading control
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-215 amino acids from the Central region of human HSPD1. |
Rabbit polyclonal HSP90B1 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HSP90B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 16-43 amino acids from the N-terminal region of human HSP90B1. |
Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Rabbit Polyclonal Antibody against DRP1
| Applications | IHC |
| Reactivities | Human, Primate, Mouse, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region within residues 500-600 of the human protein. [Swiss-Prot# O00429] |
Rabbit Polyclonal Antibody against VEGFA
| Applications | WB |
| Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Rabbit polyclonal COPE Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This COPE antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-300 amino acids from the C-terminal region of human COPE. |
Rabbit polyclonal PCYT1A Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PCYT1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-54 amino acids from the N-terminal region of human PCYT1A. |
Rabbit polyclonal TSN Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TSN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 109-138 amino acids from the Central region of human TSN. |
Rabbit polyclonal Vimentin Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Vimentin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 430-457 amino acids from the C-terminal region of human Vimentin. |
Rabbit polyclonal PCNA Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
Rabbit Polyclonal Anti-KCNQ1 Antibody
| Applications | IHC, WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI |
Rabbit polyclonal anti-Insig1 antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 248 of rat Insig1 |
Rabbit polyclonal STIP1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 269-297 amino acids from the Central region of human STIP1. |
Rabbit polyclonal HSPD1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-423 amino acids from the C-terminal region of human HSPD1. |
Rabbit polyclonal PRDX2 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This PRDX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 169-198 amino acids from the C-terminal region of human PRDX2. |
Rabbit polyclonal HMGA1 Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HMGA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 64-93 amino acids from the C-terminal region of human HMGA1. |
Rabbit polyclonal anti-Calcineurin A antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 267 of human Calcineurin A |
Rabbit polyclonal anti-SCD (stearoyl-CoA desaturase) antibody
| Applications | WB |
| Reactivities | Hamster, Human, Mouse, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 206 of rat SCD |
Rabbit polyclonal PPAR alpha antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Rat, Bovine, Dog, Golden Hamster, Boar |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1 to 18 of mouse PPAR alpha. |
Rabbit polyclonal SORBS1 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This SORBS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 866-892 amino acids from the Central region of human SORBS1. |
Rabbit polyclonal STIP1 Antibody (C-term)
| Applications | FC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 461-488 amino acids from the C-terminal region of human STIP1. |
Rabbit polyclonal Phospho-p53(S20) Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S20 of human p53. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-KCNQ2 Antibody
| Applications | IHC, WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the N terminal of human KCNQ2. Synthetic peptide located within the following region: IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKL |
Rabbit polyclonal Cyclin B1 phospho S126 antibody
| Applications | WB |
| Reactivities | Human, Rat, Dog, Chimpanzee, Mouse, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 120-131 of Human Cyclin B1 protein. |
Rabbit polyclonal TAF7 Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TAF7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 308-337 amino acids from the C-terminal region of human TAF7. |
Rabbit polyclonal Mouse CCNB1 Antibody (Center S123/S125)
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Kcnq3 Antibody
| Applications | WB |
| Reactivities | Hamster, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Kcnq3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ |
Rabbit Polyclonal Anti-KCNQ4 Antibody
| Applications | WB |
| Reactivities | Hamster, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ4 antibody: synthetic peptide directed towards the middle region of human KCNQ4. Synthetic peptide located within the following region: SSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQ |
Rabbit Polyclonal Anti-KCNQ1 Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS |
Rabbit Polyclonal Anti-ATIC Antibody
| Applications | WB |
| Reactivities | Hamster, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATIC antibody: synthetic peptide directed towards the N terminal of human ATIC. Synthetic peptide located within the following region: YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG |
USD 380.00
4 Weeks
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Hamster
Applications
- WB
Isotypes
- IgG
Filter by
Target Symbol
- VIM (3)
- CCNB1 (2)
- HSPD1 (2)
- KCNQ1 (2)
- SMAD3 (2)
- STIP1 (2)
- AGR2 (1)
- AKT1 (1)
- ATIC (1)
- CD8A (1)
- CDK2 (1)
- COPE (1)
- CTNNB1 (1)
- DDIT3 (1)
- DNM1L (1)
- FKBP4 (1)
- FKBP5 (1)
- FTH1 (1)
- GSK3B (1)
- HIF1A (1)
- HK2 (1)
- HMGA1 (1)
- HMGB1 (1)
- HSP90B1 (1)
- HSPA1A (1)
- HSPA8 (1)
- INSIG1 (1)
- KCNQ2 (1)
- KCNQ3 (1)
- KCNQ4 (1)
- KDM1A (1)
- KIF11 (1)
- KRT10 (1)
- MAPK14 (1)
- MAPK8 (1)
- MMP12 (1)
- MSN (1)
- NDUFS6 (1)
- NKX2-1 (1)
- OPA1 (1)
- PCNA (1)
- PCYT1A (1)
- PDCD6IP (1)
- PIK3R1 (1)
- PPARA (1)
- PPP3CB (1)
- PRDX2 (1)
- RAD21 (1)
- RBBP4 (1)
- RPS20 (1)
- SAT1 (1)
- SCD (1)
- SF3B1 (1)
- SMAD2 (1)
- SORBS1 (1)
- SPP1 (1)
- SRC (1)
- TAF7 (1)
- TBK1 (1)
- TOMM20 (1)
- TP53 (1)
- TPX2 (1)
- TSN (1)
- TUBA4A (1)
- TUBB (1)
- TUBG1 (1)
- VEGFA (1)
- YTHDF1 (1)
Antibody Hosts
Clonalities
Conjugates
Modifications
Families
Pathways
- MAPK signaling pathway (4)
- Pathways in cancer (4)
- Cell cycle (3)
- Metabolic pathways (3)
- Prion diseases (3)
- Amyotrophic lateral sclerosis (ALS) (2)
- Apoptosis (2)
- Base excision repair (2)
- Bladder cancer (2)
- Endocytosis (2)
- Oocyte meiosis (2)
- PPAR signaling pathway (2)
- Pancreatic cancer (2)
- Prostate cancer (2)
- RNA degradation (2)
- Renal cell carcinoma (2)
- Type I diabetes mellitus (2)
- VEGF signaling pathway (2)
- Vibrio cholerae infection (2)
- Wnt signaling pathway (2)
- mTOR signaling pathway (2)
- p53 signaling pathway (2)
- Adherens junction (1)
- Alzheimer's disease (1)
- Antigen processing and presentation (1)
- Arginine and proline metabolism (1)
- Axon guidance (1)
- B cell receptor signaling pathway (1)
- Basal cell carcinoma (1)
- Basal transcription factors (1)
- Biosynthesis of unsaturated fatty acids (1)
- Calcium signaling pathway (1)
- Chronic myeloid leukemia (1)
- Colorectal cancer (1)
- Cytokine-cytokine receptor interaction (1)
- DNA replication (1)
- Endometrial cancer (1)
- Fc gamma R-mediated phagocytosis (1)
- Focal adhesion (1)
- Gap junction (1)
- Glioma (1)
- Glycerophospholipid metabolism (1)
- Huntington's disease (1)
- Insulin signaling pathway (1)
- Long-term potentiation (1)
- Melanoma (1)
- Mismatch repair (1)
- NOD-like receptor signaling pathway (1)
- Natural killer cell mediated cytotoxicity (1)
- Neurotrophin signaling pathway (1)
- Non-small cell lung cancer (1)
- Nucleotide excision repair (1)
- One carbon pool by folate (1)
- Pathogenic Escherichia coli infection (1)
- Progesterone-mediated oocyte maturation (1)
- Purine metabolism (1)
- Small cell lung cancer (1)
- Spliceosome (1)
- T cell receptor signaling pathway (1)
- Thyroid cancer (1)