Rabbit Polyclonal Anti-RFC5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RFC5 antibody: synthetic peptide directed towards the N terminal of human RFC5. Synthetic peptide located within the following region: METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE |
Rabbit Polyclonal Anti-DDB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDB2 antibody: synthetic peptide directed towards the C terminal of human DDB2. Synthetic peptide located within the following region: IVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEF |
Mouse Monoclonal Cyclin H Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Cyclin H Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GTF2H4 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human GTF2H4 |
XPA (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | conjugated synthetic peptide selected from the C-term region of human XPA |
Cyclin H (CCNH) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
POLD1 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
DNA Ligase I (LIG1) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human DNA ligase 1 |
hHR23b (RAD23B) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of Human RAD23B. |
Rabbit Polyclonal Antibody against CUL4A (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Cullin 4A (CUL4A) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 102-131 amino acids from the N-terminal region of human Cullin 4A (CUL4A). |
Goat Polyclonal Antibody against ERCC1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DPGKDKEGVPQPS-C, from the N Terminus of the protein sequence according to NP_973730.1; NP_001974.1. |
Goat Anti-LIG1 / DNA ligase I Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RVREDKQPEQATTS, from the internal region (near C-Terminus) of the protein sequence according to NP_000225.1. |
USD 424.00
5 Days
Rabbit polyclonal RFA2 (Ser33) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of serine 33 (A-P-SP-Q-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-POLD3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POLD3. |
Rabbit polyclonal anti-PCNA antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Fish, Human, Monkey, Mouse, Rat, Xenopus, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PCNA protein. |
Rabbit polyclonal anti-PCNA antibody
| Applications | WB |
| Reactivities | Algal |
| Conjugation | Unconjugated |
| Immunogen | This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 55-71 of Isochrysis galbana PCNA. |
Goat polyclonal anti-HR23A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole goat serum produced by repeated immunizations with a synthetic peptide corresponding aa 122-135 of human HR23A protein. |
Goat polyclonal anti-HR23B antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole goat serum produced by repeated immunizations with a synthetic peptide corresponding aa 163-176 of human HR23B protein. |
Goat Polyclonal RPA1/RPA70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CKSYEDATKITVRSN (aa323-337), from the internal region of the protein sequence according to NP_002936.1 |
Anti-XPA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-ERCC3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 270 amino acids of human excision repair cross-complementing rodent repair deficiency, complementation group 3 |
Anti-MNAT1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit polyclonal CUL4B Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CUL4B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 250-278 amino acids from the Central region of human CUL4B. |
Mouse monoclonal ERCC1 Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal POLD2 Antibody (Center)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This POLD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 237-265 amino acids from the Central region of human POLD2. |
Goat Anti-ERCC6 (aa717-731) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SNASPVQVKTAYKCA, from the internal region of the protein sequence according to NP_000115.1. |
Mouse monoclonal anti-PCNA antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-CCNH antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCNH antibody: synthetic peptide directed towards the N terminal of human CCNH. Synthetic peptide located within the following region: PHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEY |
Rabbit Polyclonal anti-CDK7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDK7 antibody is: synthetic peptide directed towards the N-terminal region of Human CDK7. Synthetic peptide located within the following region: VKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDG |
Rabbit Polyclonal anti-GTF2H3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GTF2H3 antibody is: synthetic peptide directed towards the middle region of Human GTF2H3. Synthetic peptide located within the following region: KGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQY |
Rabbit Polyclonal Anti-GTF2H4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H4 antibody: synthetic peptide directed towards the N terminal of human GTF2H4. Synthetic peptide located within the following region: ALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIA |
Rabbit Polyclonal Anti-ERCC8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the N terminal of human ERCC8. Synthetic peptide located within the following region: DVERIHGGGINTLDIEPVEGRYMLSGGSDGVIVLYDLENSSRQSYYTCKA |
Rabbit Polyclonal Anti-ERCC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC2 antibody: synthetic peptide directed towards the N terminal of human ERCC2. Synthetic peptide located within the following region: KLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVS |
Rabbit Polyclonal Anti-GTF2H2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the N terminal of human GTF2H2. Synthetic peptide located within the following region: DILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTL |
Rabbit Polyclonal Anti-GTF2H2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the middle region of human GTF2H2. Synthetic peptide located within the following region: HHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCD |
Rabbit Polyclonal Anti-GTF2H1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H1 antibody: synthetic peptide directed towards the middle region of human GTF2H1. Synthetic peptide located within the following region: ERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKK |
Rabbit Polyclonal Anti-CCNH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCNH antibody: synthetic peptide directed towards the middle region of human CCNH. Synthetic peptide located within the following region: KQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL |
Rabbit Polyclonal Anti-MNAT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MNAT1 antibody: synthetic peptide directed towards the N terminal of human MNAT1. Synthetic peptide located within the following region: DDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGT |
Rabbit Polyclonal Anti-CDK7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the middle region of human CDK7. Synthetic peptide located within the following region: TQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALE |
Rabbit Polyclonal Anti-GTF2H4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H4 antibody: synthetic peptide directed towards the N terminal of human GTF2H4. Synthetic peptide located within the following region: ESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSL |
Rabbit Polyclonal Anti-POLE3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-POLE3 Antibody: synthetic peptide directed towards the N terminal of human POLE3. Synthetic peptide located within the following region: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATS |
Rabbit Polyclonal Anti-RPA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPA4 antibody: synthetic peptide directed towards the middle region of human RPA4. Synthetic peptide located within the following region: VPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCD |
Rabbit Polyclonal Anti-RPA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPA4 antibody: synthetic peptide directed towards the C terminal of human RPA4. Synthetic peptide located within the following region: HQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD |
Rabbit Polyclonal Anti-ERCC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC3 antibody: synthetic peptide directed towards the N terminal of human ERCC3. Synthetic peptide located within the following region: MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG |
Rabbit Polyclonal Anti-ERCC6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC6 antibody is: synthetic peptide directed towards the C-terminal region of Human ERCC6. Synthetic peptide located within the following region: EASALLPTTEHDDLLVEMRNFIAFQAHTDGQASTREILQEFESKLSASQS |
Germany
Japan
United Kingdom
China
