Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Anti-BIRC5/Survivin mouse mAb, clone OTI2D9, DyLight488 conjugated
| Applications | FC |
| Reactivities | Human |
| Conjugation | DyLight 488 |
Anti-BIRC5/Survivin mouse mAb, clone OTI2D9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Anti-BIRC5/Survivin mouse mAb, clone OTI2D9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
| Applications | ELISA, FN, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Phospho-IGF1R-Y1161 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1161 of human IGF1R |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against AKT2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit Polyclonal c-Jun (Ser73) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Jun around the phosphorylation site of Serine 73 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TCF7L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Active filters
Pathways
- Colorectal cancer
Availabilities
- In Stock
Filter by
Target Symbol
- MAP2K1 (86)
- TP53 (83)
- JUN (74)
- EGFR (73)
- CTNNB1 (53)
- BRAF (44)
- AKT1 (35)
- MLH1 (31)
- BCL2 (28)
- PIK3CG (26)
- FOS (24)
- MET (24)
- KRAS (23)
- PDGFRB (22)
- MAPK1 (21)
- PDGFRA (21)
- PIK3R5 (19)
- AKT2 (17)
- MYC (17)
- BIRC5 (15)
- CASP3 (15)
- PIK3CD (15)
- DVL2 (14)
- CCND1 (13)
- IGF1R (12)
- MAPK8 (12)
- BAX (11)
- MAPK9 (11)
- RAF1 (10)
- ARAF (9)
- MAPK3 (9)
- APC (8)
- BAD (8)
- PIK3CA (8)
- TGFB1 (8)
- CASP9 (7)
- MSH6 (7)
- SMAD2 (7)
- APPL1 (6)
- DCC (6)
- SMAD3 (6)
- TGFBR2 (6)
- AKT3 (5)
- MAPK10 (5)
- MSH2 (5)
- FZD8 (4)
- RAC1 (4)
- ACVR1C (3)
- FZD1 (3)
- FZD3 (3)
- FZD4 (3)
- ACVR1B (2)
- CYCS (2)
- FZD10 (2)
- FZD2 (2)
- GRB2 (2)
- LEF1 (2)
- PIK3R3 (2)
- TGFBR1 (2)
- AXIN1 (1)
- AXIN2 (1)
- DVL3 (1)
- FZD5 (1)
- FZD6 (1)
- FZD7 (1)
- FZD9 (1)
- GSK3B (1)
- PIK3CB (1)
- PIK3R1 (1)
- PIK3R2 (1)
- RAC2 (1)
- SMAD4 (1)
- SOS2 (1)
- TCF7 (1)
- TCF7L1 (1)
- TCF7L2 (1)
- TGFB2 (1)
- TGFB3 (1)
Reactivities
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (1007)
- ES Cell Differentiation/IPS (442)
- Protein Kinase (430)
- Transcription Factors (278)
- Transmembrane (233)
- Stem cell - Pluripotency (175)
- Stem cell relevant signaling - JAK/STAT signaling pathway (116)
- Cancer stem cells (86)
- Secreted Protein (83)
- Adult stem cells (75)
- Stem cell relevant signaling - Wnt Signaling pathway (31)
- Embryonic stem cells (30)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (30)
- Protease (22)
- Induced pluripotent stem cells (18)
- GPCR (16)
- Stem cell relevant signaling - DSL/Notch pathway (13)