Germany
Japan
United Kingdom
China
USD 420.00
In Stock
Antibodies
Download
USD 379.00
In Stock
USD 379.00
In Stock
Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-TKT antibody for SISCAPA, clone OTIR4F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-NNMT antibody for SISCAPA, clone OTIR1F6
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-P5CR1 antibody for SISCAPA, clone OTIR1E8
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 399.00
In Stock
Anti-IDH1 mouse mAb, clone OTI2H9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 399.00
In Stock
Anti-IDH1 mouse mAb, clone OTI2H9, DyLight488 conjugated
| Applications | FC |
| Reactivities | Human |
| Conjugation | DyLight 488 |
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
Rabbit Polyclonal Anti-TDO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TDO2 antibody: synthetic peptide directed towards the N terminal of human TDO2. Synthetic peptide located within the following region: LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV |
USD 399.00
In Stock
Anti-IDH1 mouse mAb, clone OTI2H9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 379.00
In Stock
USD 379.00
In Stock
Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329) |
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
| Modifications | Phospho-specific |
Anti-GAPDH mouse mAb (Loading control)
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to GALNS (galactosamine (N-acetyl)-6-sulfate sulfatase)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 20 and 259 of GALNS |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against GOT1 (Internal region)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSYRYWDAEKR, from the internal region of the protein sequence according to NP_002070.1. |
Rabbit Polyclonal Antibody against PHPT1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PHPT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 88-117 amino acids from the C-terminal region of human PHPT1. |
Rabbit polyclonal anti-OAT antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human OAT. |
Rabbit Polyclonal Anti-INPP5K Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF |
Active filters
Pathways
- Metabolic pathways
Availabilities
- In Stock
Filter by
Target Symbol
- NME1 (78)
- OTC (50)
- LIPG (49)
- PIK3C2A (44)
- TYMS (34)
- FTCD (29)
- IDO1 (28)
- TYMP (27)
- ABAT (26)
- AMACR (26)
- RRM1 (24)
- TH (24)
- IDO2 (23)
- ATP6V1C2 (22)
- UPRT (22)
- ASS1 (21)
- CYP1A2 (21)
- HADH (20)
- PNMT (20)
- CMPK1 (19)
- GCH1 (19)
- LTA4H (19)
- ALOX5 (18)
- ACAA2 (17)
- GBA (17)
- IDH1 (17)
- AMDHD1 (16)
- THTPA (16)
- DGKA (15)
- GAPDH (15)
- NDUFB10 (15)
- MCEE (14)
- PFKP (14)
- PISD (14)
- PPAT (14)
- RPN1 (14)
- ACY1 (13)
- ARG1 (13)
- HPRT1 (13)
- NANP (13)
- TDO2 (13)
- ACSS2 (12)
- AKR1A1 (12)
- ATP5F1B (12)
- GLB1 (12)
- HMBS (12)
- MGLL (12)
- NME4 (12)
- PAFAH1B3 (12)
- PAPSS2 (12)
- PGAM4 (12)
- SDHB (12)
- UCK1 (12)
- ACAT2 (11)
- LDHA (11)
- NFKB1 (11)
- POLR2H (11)
- PON3 (11)
- PYCR2 (11)
- SHMT2 (11)
- SMS (11)
- SPR (11)
- ADH1B (10)
- ADH5 (10)
- AK1 (10)
- AK5 (10)
- ENO2 (10)
- HIBCH (10)
- HSD17B4 (10)
- NDUFA7 (10)
- NOS2 (10)
- PAICS (10)
- PGAM2 (10)
- PON1 (10)
- SORD (10)
- UQCRC1 (10)
- AK4 (9)
- ALDH3A2 (9)
- ANPEP (9)
- CYP17A1 (9)
- CYP2J2 (9)
- DLD (9)
- DTYMK (9)
- KHK (9)
- NAT1 (9)
- NDUFA4L2 (9)
- NDUFB9 (9)
- PIKFYVE (9)
- PYCR3 (9)
- QPRT (9)
- SDS (9)
- TALDO1 (9)
- TBXAS1 (9)
- ACO2 (8)
- ALDOB (8)
- ALOX15 (8)
- ATP6V1B1 (8)
- CAT (8)
- CPS1 (8)
- CYP2A6 (8)
Reactivities
- Human (2634)
- Mouse (1836)
- Rat (1768)
- Dog (185)
- Monkey (180)
- Bovine (18)
- Pig (13)
- Chimpanzee (6)
- Cow (6)
- Gorilla (6)
- Rabbit (6)
- X. tropicalis (6)
- Xenopus (6)
- Canine (5)
- Chicken (5)
- Gibbon (5)
- Zebrafish (5)
- Hamster (3)
- Horse (3)
- Orang-Utan (3)
- Primate (3)
- Feline (2)
- Guinea Pig (2)
- Rhesus Monkey (2)
- Bat (1)
- Equine (1)
- Goat (1)
- Porcine (1)
- Sheep (1)