Antibodies

View as table Download

Rabbit anti-ADH5 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ADH5

Rabbit anti-UGT1A1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A1

Rabbit anti-ALDH1A1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH1A1

Anti-ADH5 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-CYP2C19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2C19 antibody: synthetic peptide directed towards the middle region of human CYP2C19. Synthetic peptide located within the following region: QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD

Rabbit Polyclonal Anti-CYP1A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV

Rabbit Polyclonal Anti-ADH1B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the C terminal of human ADH1B. Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV

Rabbit Polyclonal Anti-Cytochrome P450 2C19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Cytochrome P450 2C19 Antibody: A synthesized peptide derived from human Cytochrome P450 2C19

Rabbit Polyclonal Anti-CYP26B1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP26B1 antibody: synthetic peptide directed towards the N terminal of human CYP26B1. Synthetic peptide located within the following region: LRWAATRDKSCKLPIPKGSMGFPLIGETGHWLLQGSGFQSSRREKYGNVF

Rabbit Polyclonal Anti-CYP1A1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV

Rabbit Polyclonal Anti-ADH1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADH1A antibody: synthetic peptide directed towards the N terminal of human ADH1A. Synthetic peptide located within the following region: ESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENA

Rabbit Polyclonal Anti-CYP2C9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2C9 antibody: synthetic peptide directed towards the C terminal of human CYP2C9. Synthetic peptide located within the following region: AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV

Rabbit Polyclonal Anti-Cytochrome P450 26A1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cytochrome P450 26A1 Antibody: A synthesized peptide derived from human Cytochrome P450 26A1

Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656)

Rabbit polyclonal anti-LRAT antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LRAT.

Rabbit polyclonal CYP1A2 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CYP1A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-282 amino acids from the Central region of human CYP1A2.

UGT1A9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A9

Rabbit anti-CYP1A1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CYP1A1

Rabbit Polyclonal Anti-ADH1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADH1A antibody: synthetic peptide directed towards the N terminal of human ADH1A. Synthetic peptide located within the following region: NYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVA

Rabbit Polyclonal Anti-Adh7 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Adh7 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Adh7. Synthetic peptide located within the following region: LTYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLDQLITHTL

Rabbit Polyclonal antibody to ALDH1A2 (aldehyde dehydrogenase 1 family, member A2)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 278 and 518 of ALDH1A2 (Uniprot ID#O94788)

Rabbit polyclonal anti-DHRS4 antibody

Applications IHC, WB
Reactivities Human (Identities = 100%, Positives = 100%
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DHRS4.

Rabbit polyclonal Cytochrome P450 26C1 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 26C1.

Rabbit polyclonal CYP2B6 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CYP2B6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 235-263 amino acids from the Central region of human CYP2B6.

Rabbit polyclonal ALDH1A1 Antibody

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ALDH1A1 antibody is generated from rabbits immunized with human ALDH1A1 recombinant protein.

Rabbit polyclonal ADH1B Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ADH1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-237 amino acids from the Central region of human ADH1B.

Rabbit polyclonal ADH7 Antibody (C-Term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ADH7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-346 amino acids from the C-terminal region of human ADH7.

Rabbit anti-CYP2A6 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CYP2A6

Rabbit Polyclonal Anti-CYP26B1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP26B1 antibody: synthetic peptide directed towards the middle region of human CYP26B1. Synthetic peptide located within the following region: SRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEILPETEAMLSAT

Rabbit Polyclonal Anti-ADH1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the N terminal of human ADH1B. Synthetic peptide located within the following region: STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDD

Rabbit Polyclonal Anti-ADH6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADH6 antibody: synthetic peptide directed towards the middle region of human ADH6. Synthetic peptide located within the following region: AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID

Rabbit Polyclonal Anti-CYP2A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2A7 antibody: synthetic peptide directed towards the N terminal of human CYP2A7. Synthetic peptide located within the following region: MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLN

Rabbit Polyclonal Anti-CYP3A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP3A7 antibody: synthetic peptide directed towards the middle region of human CYP3A7. Synthetic peptide located within the following region: KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI

Rabbit Polyclonal Anti-CYP3A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP3A7 antibody: synthetic peptide directed towards the middle region of human CYP3A7. Synthetic peptide located within the following region: KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSG

Rabbit Polyclonal Anti-CYP2A13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2A13 antibody: synthetic peptide directed towards the C terminal of human CYP2A13. Synthetic peptide located within the following region: DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF

Rabbit Polyclonal Anti-CYP2A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CYP2A7 antibody is: synthetic peptide directed towards the C-terminal region of Human CYP2A7. Synthetic peptide located within the following region: EGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVVFATIPRNYTMSF

Rabbit Polyclonal Anti-CYP2B6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2B6 antibody: synthetic peptide directed towards the middle region of human CYP2B6. Synthetic peptide located within the following region: QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL

Rabbit Polyclonal Anti-CYP2C18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2C18 antibody: synthetic peptide directed towards the N terminal of human CYP2C18. Synthetic peptide located within the following region: MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM

Rabbit Polyclonal Anti-RDH11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RDH11 antibody: synthetic peptide directed towards the C terminal of human RDH11. Synthetic peptide located within the following region: SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR

Rabbit Polyclonal Anti-LRAT Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-LRAT Antibody: A synthesized peptide derived from human LRAT

Rabbit Polyclonal Anti-Cytochrome P450 2B6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Cytochrome P450 2B6 Antibody: A synthesized peptide derived from human Cytochrome P450 2B6

Rabbit Polyclonal Anti-Cytochrome P450 1A1/2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cytochrome P450 1A1/2 Antibody: A synthesized peptide derived from human Cytochrome P450 1A1/2

Goat Polyclonal Anti-CYP26A1 Antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CYP26A1 Antibody: Peptide with sequence C-NLPARFTHFHGE, from the internal region of the protein sequence according to NP_000774.2; NP_476498.1.

Rabbit polyclonal antibody to Cytochrome P450 4A11 (cytochrome P450, family 4, subfamily A, polypeptide 11)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 48 and 316 of CYP4A11 (Uniprot ID#Q02928)

Rabbit polyclonal Cytochrome P450 26A1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 26A1.

Rabbit polyclonal Cytochrome P450 1A1/2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A1/2.

Rabbit polyclonal Cytochrome P450 2B6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2B6.
Modifications Phospho-specific

Rabbit polyclonal Cytochrome P450 2B6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human Cytochrome P450 2B6.
Modifications Phospho-specific

Rabbit polyclonal Cytochrome P450 2C8 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8.
Modifications Phospho-specific

Rabbit polyclonal Cytochrome P450 1A2 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A2.