Antibodies

View as table Download

Rabbit Polyclonal Anti-F2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE

Plasminogen (PLG) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Biotin
Immunogen Plasminogen isolated and purified from human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Plasminogen (PLG) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Immunogen Plasminogen isolated and purified from Human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Plasminogen (PLG) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Immunogen Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure.

Goat polyclonal Plasminogen antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Plasminogen [Human Plasma]

Rabbit Polyclonal Anti-F2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-F2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRR

Rabbit Polyclonal Anti-THRB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-THRB Antibody: A synthesized peptide derived from human THRB

Rabbit Polyclonal Anti-Cathepsin G Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cathepsin G Antibody: A synthesized peptide derived from human Cathepsin G

Plasminogen (PLG) goat polyclonal antibody, Serum

Applications ID, IP, R
Reactivities Human
Immunogen Native plasminogen is a single polypeptide chain, synthesized in the liver. Its molecular weight has been reported to be 81,000 and 92,000. Part of the molecule contains the active serine esterase of plasmin. On activation it is converted to two polypeptide chains linked by disulphide bridges. Three different abnormal molecular forms of plasminogen have been described. Normal adult plasma contains 10-20 mg/100 ml plasminogen. Different congenital molecular structure abnormalities associated with recurrent thrombosis have been described, but are extremely rare. In liver disease plasminogen activity may be reduced. Freund’s complete adjuvant is used in the first step of the immunization procedure.

Trypsin (PRSS3) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 143-171 amino acids from the Central region of Human Trypsin-3 / PRSS3

Trypsin (PRSS3) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 20-48aa) of human Trypsin-3 / PRSS3

Rabbit polyclonal Prothrombin / THRB (AP2, Cleaved-Arg327) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human THRB.

Rabbit polyclonal anti-PLG antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human PLG.

Rabbit polyclonal PLG Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PLG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 636-665 amino acids from the C-terminal region of human PLG.

Prothrombin (F2) mouse monoclonal antibody, clone CaPro-20, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin

Prothrombin (F2) mouse monoclonal antibody, clone CaPro-20, Purified

Applications ELISA, WB
Reactivities Human

Cathepsin G (CTSG) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide, corresponding to amino acids 71-120 of Human Cathepsin G.

Plasminogen (PLG) rabbit polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Immunogen Plasminogen isolated and purified from Human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit polyclonal CATG (Cleaved-Ile21) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CATG.

Rabbit polyclonal PLMN (heavy chain A short form, Cleaved-Val98) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PLMN.

Goat polyclonal Plasminogen antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Plasminogen [Human Plasma]

Rabbit Polyclonal Anti-GZMA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GZMA antibody: synthetic peptide directed towards the middle region of human GZMA. Synthetic peptide located within the following region: TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNS

Rabbit Polyclonal Anti-GZMA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GZMA antibody: synthetic peptide directed towards the C terminal of human GZMA. Synthetic peptide located within the following region: LRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKH

Rabbit Polyclonal Anti-PLG

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLG antibody: synthetic peptide directed towards the middle region of human PLG. Synthetic peptide located within the following region: LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE

Rabbit polyclonal Anti-PRSS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRSS3 antibody: synthetic peptide directed towards the N terminal of human PRSS3. Synthetic peptide located within the following region: VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH

Carrier-free (BSA/glycerol-free) PLG mouse monoclonal antibody,clone OTI4F5

Applications IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) F2 mouse monoclonal antibody,clone OTI5B11

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) F2 mouse monoclonal antibody,clone OTI5G10

Applications WB
Reactivities Human
Conjugation Unconjugated

Anti-CTSG Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 21-255 amino acids of human cathepsin G

Rabbit Polyclonal Anti-PLG Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLG

Rabbit Polyclonal Anti-F2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human F2

CTSG Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated