Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Progesterone Receptor (PGR) mouse monoclonal antibody, Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
Rabbit polyclonal Androgen Receptor (Ab-650) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Androgen Receptor around the phosphorylation site of serine 650 (T-T-SP-P-T). |
Rabbit polyclonal Cyclin E1 (Ab-395) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-T-P-P). |
Rabbit anti-PPP2R1A Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP2R1A |
Rabbit polyclonal Cyclin E1 (Thr395) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-TP-P-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PPP2R1B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R1B antibody: synthetic peptide directed towards the N terminal of human PPP2R1B. Synthetic peptide located within the following region: EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ |
Rabbit Polyclonal Anti-PPP2R1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPP2R1A antibody is: synthetic peptide directed towards the N-terminal region of HUMAN PPP2R1A. Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL |
Rabbit Polyclonal Anti-Ppp3cb Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ppp3cb antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI |
Rabbit Polyclonal Anti-Ppp3cb Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS |
Rabbit Polyclonal Anti-PPP2R1A Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R1A antibody: synthetic peptide directed towards the middle region of human PPP2R1A. Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL |
Rabbit Polyclonal Anti-PTTG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTTG1 Antibody: A synthesized peptide derived from human PTTG1 |
14 3 3 eta (YWHAH) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 50-100 of Human 14-3-3 η. |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit polyclonal antibody to Progesterone receptor (progesterone receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 18 and 112 of Progesterone Receptor (Uniprot ID#P06401) |
Rabbit polyclonal Androgen Receptor (Ab-213) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Androgen Receptor around the phosphorylation site of serine 213 (E-A-SP-G-A). |
Rabbit Polyclonal Cyclin E1 (Thr395) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin E1 around the phosphorylation site of Threonine 395 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Cyclin E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin E1 |
Rabbit Polyclonal Progesterone Receptor Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor |
Rabbit Polyclonal Progesterone Receptor (Ser294) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor around the phosphorylation site of Serine 294 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Progesterone Receptor (Ser400) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor around the phosphorylation site of Serine 400 |
| Modifications | Phospho-specific |
Rabbit polyclonal Androgen Receptor (Phospho-Tyr363) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Androgen Receptor around the phosphorylation site of tyrosine 363 (D-Y-YP-N-F). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Androgen Receptor (Ser650) Antibody (Phospho-specific)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Androgen Receptor around the phosphorylation site of Serine 650 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Progesterone Receptor Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor |
PPP2R1A rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH |
PPP2R1A sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH corresponding to amino acids 7-19 sequence (N-terminal) of PP2A/A regulatory subunit having a MW of 65kD |
PPP2R1B rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH |
PPP2R1B sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The immunogen used to the purified peptide conjugated to KLH corresponding to the sequence NH2-Phe-Ser-Gln-Val-Lys-Gly-Ala-Val-Asp-Asp-Asp-Val-Ala-Glu-COOH. This peptide antibody corresponds to N -terminal peptide of PP2A/B a regulatory subunit having a MW of 55kD. |
PP2A-alpha (PPP2CA) sheep polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH |
Androgen Receptor (AR) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide corresponding to sequence around amino acids 648~652 (T-T-S-P-T) derived from Human Androgen Receptor. |
Rabbit polyclonal anti-Calcineurin A antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 267 of human Calcineurin A |
Rabbit polyclonal PGR/PR Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PGR/PR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 816-843 amino acids from the C-terminal region of human PGR/PR. |
Rabbit Polyclonal Androgen Receptor Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Androgen Receptor |
Rabbit Polyclonal Cyclin E1 (Thr395) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Cyclin E1 around the phosphorylation site of Threonine 395. |
| Modifications | Phospho-specific |
Rabbit polyclonal Androgen Receptor (Ab-363) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Androgen Receptor around the phosphorylation site of tyrosine 363 (D-Y-YP-N-F). |
Rabbit Polyclonal Anti-YWHAH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YWHAH antibody: synthetic peptide directed towards the N terminal of human YWHAH. Synthetic peptide located within the following region: ADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKV |
Rabbit anti Progesterone Receptor (PR) Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to C-terminus of human Progesterone receptor. This sequence is identical within human, mouse, rat, chicken, bovine and dog origins. |
