Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-TGFR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGFR2 Antibody: A synthesized peptide derived from human TGFR2 |
Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Goat Polyclonal Antibody against HSPA8 (Isoform 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1. |
Rabbit polyclonal Filamin A (Ser2152) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Filamin A around the phosphorylation site of serine 2152 (A-P-SP-V-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-MAP4K3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human MAP4K3. |
Rabbit Polyclonal Trk B (Tyr515) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Trk B around the phosphorylation site of Tyrosine 515 (peptide seq 509-521aa: VIENPQY(p)FGITN) |
| Modifications | Phospho-specific |
Rabbit Polyclonal Stathmin 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Stathmin 1 |
Mouse monoclonal Hsp70/Hsc70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Beluga, Canine, Chicken, Drosophila, Fish, Guinea pig, Hamster, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
Rabbit polyclonal Hsp70 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Beluga, Cow, Dog, Fish (carp), Guinea Pig, Hamster, Monkey, Pig, Sheep, Coral, Tomato, Tobacco, Spiny Dogfish Shark (Squalus acanthias), Atlantic Hagfish (Myxine glutinosa) |
| Conjugation | Unconjugated |
| Immunogen | Full length human protein Hsp70 |
Rabbit anti-NFKB2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human NFKB2 |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Filamin A (Ser2152) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Filamin A around the phosphorylation site of Serine 2152 |
| Modifications | Phospho-specific |
Rabbit Polyclonal JNK1/2/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Rabbit polyclonal p38 MAPK (Ab-322) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q). |
Rabbit polyclonal p38 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Pig |
| Conjugation | Unconjugated |
| Immunogen | A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
NFATC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human NFATC2 |
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat, Tobacco hornworm |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
Goat Polyclonal Anti-DUSP6 / MKP3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DUSP6 / MKP3 Antibody: Peptide with sequence C-PSNQNVYQVDSLQST, from the C Terminus of the protein sequence according to NP_001937.2; NP_073143.2. |
Rabbit polyclonal COT (Ab-290) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human COT around the phosphorylation site of threonine 290 (R-G-TP-E-I). |
Rabbit polyclonal JIP1 (Ab-103) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human JIP1 around the phosphorylation site of threonine 103 (G-D-TP-P-G). |
Rabbit polyclonal NRAS Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS. |
Active filters
Filter by
Target Symbol
- MAP2K1 (224)
- JUN (176)
- MAP2K3 (155)
- EGFR (139)
- GADD45G (133)
- AKT1 (109)
- MAPK13 (96)
- BRAF (90)
- MAPK1 (69)
- MEF2C (61)
- FGFR2 (59)
- FOS (59)
- MAPK7 (57)
- KRAS (56)
- MAPT (56)
- PDGFRA (55)
- MAPKAPK5 (51)
- PPP5C (51)
- HSPA1A (45)
- PPM1B (45)
- HRAS (44)
- RASGRP3 (40)
- RPS6KA2 (40)
- AKT2 (38)
- MAPK8 (37)
- PDGFRB (36)
- CASP3 (35)
- MAP2K4 (34)
- FGFR1 (33)
- MAPK14 (32)
- MYC (32)
- DUSP5 (30)
- MAP2K2 (30)
- CHP1 (27)
- DDIT3 (27)
- MAPK9 (27)
- HSPA1L (26)
- IKBKG (23)
- MAPK8IP1 (23)
- DUSP1 (22)
- DUSP10 (22)
- NTF3 (22)
- RELA (22)
- ARRB1 (21)
- PRKCA (21)
- MAP3K8 (20)
- RASA1 (20)
- ATF2 (19)
- FGF2 (19)
- MAPK10 (19)
- TP53 (19)
- ATF4 (17)
- PTPN7 (17)
- AKT3 (16)
- MAP3K7 (16)
- NTRK2 (16)
- RAF1 (16)
- TGFB1 (16)
- HSPA8 (15)
- MAPK3 (15)
- NFKB1 (14)
- STMN1 (14)
- TGFBR2 (14)
- CHUK (13)
- FGFR3 (13)
- IKBKB (13)
- PAK1 (13)
- DUSP4 (12)
- GADD45A (12)
- MAP3K13 (12)
- NRAS (12)
- PLA2G6 (12)
- FGF13 (11)
- NTF4 (11)
- MAP2K6 (10)
- NTRK1 (10)
- STK3 (10)
- ELK1 (9)
- JUND (9)
- FGF1 (8)
- PPP3CA (8)
- PPP3CB (8)
- PRKCB (8)
- RPS6KA1 (8)
- NFKB2 (7)
- PAK2 (7)
- RRAS (7)
- TGFB2 (7)
- TGFBR1 (7)
- BDNF (6)
- MAPK11 (6)
- MAPK12 (6)
- DUSP3 (5)
- FGF4 (5)
- FLNA (5)
- GRB2 (5)
- MAP3K5 (5)
- MAPKAPK2 (5)
- MRAS (5)
- PDGFB (5)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (2891)
- Protein Kinase (1770)
- Transcription Factors (784)
- ES Cell Differentiation/IPS (740)
- Transmembrane (446)
- Secreted Protein (344)
- Phosphatase (185)
- Stem cell relevant signaling - JAK/STAT signaling pathway (171)
- Adult stem cells (156)
- Cancer stem cells (139)
- Stem cell - Pluripotency (137)
- Embryonic stem cells (49)
- Induced pluripotent stem cells (46)
- Stem cell relevant signaling - Wnt Signaling pathway (37)
- Protease (35)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (32)
- Ion Channels: Other (13)
- Ion Channels: Calcium (10)
- Nuclear Hormone Receptor (4)