Germany
Japan
United Kingdom
China
B7-2 (CD86) mouse monoclonal antibody, clone B-T7, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
Antibodies
View as table Download
TSH beta (TSHB) (intact) mouse monoclonal antibody, clone B31, Purified
| Applications | ELISA, Labeling |
| Reactivities | Human |
CTLA4 mouse monoclonal antibody, clone A3.4H2.H12, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
IL10 mouse monoclonal antibody, clone BN-10, PE
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | PE |
CD40L (CD40LG) (C-term) rabbit polyclonal antibody
| Applications | FC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human TRAP |
Fas Ligand (FASLG) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | FASLG antibody was raised against peptide mapping near the amino terminus of rat FAS-L |
Fas Ligand (FASLG) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence mapping at the C-terminal of human FAS-L |
IL2 mouse monoclonal antibody, clone 4F12, Azide Free
| Applications | ELISA, FN |
| Reactivities | Birds, Chicken, Mammalian |
Goat Polyclonal Antibody against thyroid peroxidase
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TRHVIQVSNEVVTDD, from the internal region of the protein sequence according to NP_000538.3; NP_783650.1; NP_783652.1; NP_783653.1. |
Goat Anti-TSHR (aa101-115) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SKVTHIEIRNTRNLT, from the internal region of the protein sequence according to NP_000360.2; NP_001018046.1. |
Goat Anti-CD28 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SQQLQVYSKTGFNCD, from the internal region of the protein sequence according to NP_006130.1. |
Rabbit polyclonal anti-IL-2 antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed human IL-2 |
Rabbit polyclonal anti-IL-4 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed recombinant human IL-4 |
Mouse Anti-Human HLA-E Purified (25 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human IL-4 Purified (50 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal HLA-G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TSHR Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TSH Receptor / TSHR antibody was raised against synthetic 19 amino acid peptide from C-terminus of human TSH Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Bat, Dog, Elephant, Horse, Pig, Guinea pig (94%); Mouse, Rat, Sheep, Cat, Bovine, Hamster, Panda, Rabbit, Opossum (89%). |
Rabbit Polyclonal Anti-HLA-A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ |
purified CD80 Capture mouse monoclonal antibody, Luminex validated, clone OTI2E5
| Applications | LMNX |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700489 |
Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO35
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL2 mouse monoclonal antibody, clone 5A8, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL2 mouse monoclonal antibody, clone 9F9, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL2 mouse monoclonal antibody, clone 10C4, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL2 mouse monoclonal antibody, clone 8C2, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL2 mouse monoclonal antibody, clone 6F11, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL2 mouse monoclonal antibody, clone 6B1, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
hCG (CGA) mouse monoclonal antibody, clone FSH-1, Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
hCG (CGA) mouse monoclonal antibody, clone HCG-1, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
hCG (CGA) mouse monoclonal antibody, clone TSH-1, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD28 mouse monoclonal antibody, clone CD28.2, APC
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | APC |
CD28 mouse monoclonal antibody, clone CD28.2, FITC
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | FITC |
CD28 mouse monoclonal antibody, clone CD28.2, PE
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | PE |
hCG (CGA) mouse monoclonal antibody, clone n.a, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
Fas Ligand (FASLG) mouse monoclonal antibody, clone B-R17, Biotin
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
Perforin (PRF1) mouse monoclonal antibody, clone B-D48, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
Perforin (PRF1) mouse monoclonal antibody, clone B-D48, PerCP
| Applications | FC |
| Conjugation | PerCP |
Perforin (PRF1) mouse monoclonal antibody, clone B-D48, Purified
| Applications | FC |
| Reactivities | Human |
Perforin (PRF1) mouse monoclonal antibody, clone B-D48, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
CD40 mouse monoclonal antibody, clone B-B20, Biotin
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
CD40 mouse monoclonal antibody, clone B-B20, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
Active filters
Category
- Antibodies
Pathways
- Autoimmune thyroid disease
Filter by
Target Symbol
- TG (137)
- CD40 (125)
- CD80 (103)
- CTLA4 (99)
- CD86 (62)
- CD28 (37)
- IL2 (36)
- IL4 (23)
- IL10 (20)
- FAS (19)
- HLA-A (18)
- PRF1 (18)
- SMURF2 (18)
- GZMB (16)
- CD40LG (13)
- FASLG (13)
- HLA-DQA2 (13)
- CGA (10)
- TSHR (9)
- IL5 (8)
- HLA-G (7)
- IFNA2 (7)
- HLA-DRB5 (6)
- IFNA6 (6)
- TPO (6)
- TSHB (6)
- HLA-B (4)
- HLA-DRA (4)
- HLA-DMB (3)
- HLA-DRB3 (3)
- HLA-E (3)
- HLA-DMA (2)
- HLA-DOA (2)
- HLA-DOB (2)
- HLA-DPA1 (2)
- HLA-DPB1 (2)
- HLA-F (2)
- IFNA16 (2)
- IFNA4 (2)
- HLA-C (1)
- HLA-DQA1 (1)
- HLA-DQB1 (1)
- HLA-DRB1 (1)
- HLA-DRB4 (1)
- IFNA1 (1)
- IFNA13 (1)
- IFNA17 (1)
- IFNA5 (1)
- IFNA7 (1)
- IFNA8 (1)