Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal Anti-ISG15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Rabbit anti-PGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGF |
Rabbit Polyclonal Anti-MGP
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MGP antibody: synthetic peptide directed towards the middle region of human MGP. Synthetic peptide located within the following region: INRRNANTFISPQQRWRAKVQERIRERSKPVHELNREACDDYRLCERYAM |
Goat Polyclonal Antibody against DKK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Rabbit anti-GHRH Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GHRH |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Rabbit Polyclonal Anti-PTHLH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTHLH antibody: synthetic peptide directed towards the middle region of human PTHLH. Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS |
Rabbit Polyclonal VGF Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VGF antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of the human VGF. The immunogen is located within the last 50 amino acids of VGF. |
Chicken Polyclonal Albumin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Albumin antibody was raised against a 13 amino acid synthetic peptide near the center of human Albumin. The immunogen is located within amino acids 340 - 390 of Albumin. |
Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20) |
Rabbit Polyclonal Anti-MSTN Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mstn antibody is: synthetic peptide directed towards the C-terminal region of Mouse Mstn. Synthetic peptide located within the following region: APKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPIN |
Rabbit Polyclonal Anti-Interleukin 12A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 12A Antibody: A synthesized peptide derived from human Interleukin 12A |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
ADAMTS1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%). |
Rabbit polyclonal FOLR1 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FOLR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-68 amino acids from the N-terminal region of human FOLR1. |
Rabbit anti-AZGP1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AZGP1 |
Rabbit Polyclonal Anti-ANGPT2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Angpt2 antibody is: synthetic peptide directed towards the middle region of Mouse Angpt2. Synthetic peptide located within the following region: NQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEG |
Goat Anti-IL18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NPPDNIKDTKSDI, from the internal region of the protein sequence according to NP_001553.1. |
Rabbit polyclonal antibody to Dopamine beta-Hydroxylase (dopamine beta-hydroxylase (dopamine beta-monooxygenase))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 8 and 320 of Dopamine beta Hydroxylase (Uniprot ID#P09172) |
Rabbit polyclonal CMGA Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CMGA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 376-404 amino acids from the C-terminal region of human CMGA. |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit polyclonal anti-LAMC1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMC1. |
Goat Polyclonal Antibody against Biglycan Preproprotein
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DRLAIQFGNYKK, from the C Terminus of the protein sequence according to NP_001702.1. |
Rabbit Polyclonal Factor VIII Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Factor VIII. |
Rabbit Polyclonal Anti-PDYN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pdyn antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLTVSGLRGKDDLEDEVALEEGYSALAKLLEPVLKELEKSRLLTSVPEEK |
Rabbit polyclonal anti-Neuropilin-1 antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 816 of mouse Neuropilin 1 |
Rabbit anti-CAMP Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CAMP |
Rabbit Polyclonal Anti-PCOLCE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCOLCE antibody: synthetic peptide directed towards the middle region of human PCOLCE. Synthetic peptide located within the following region: LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS |
Anti-VTN Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 141-154 amino acids of human vitronectin |
Anti-PLAT Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-267 amino acids of human plasminogen activator, tissue |
Anti-KLK5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 279-293 amino acids of Human kallikrein-related peptidase 5 |
Anti-SV2A Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 21-35 amino acids of human synaptic vesicle glycoprotein 2A |
Active filters
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- Secreted Protein
Citations
- Yes
Filter by
Category
Target Symbol
- BDNF (2)
- IL18 (2)
- SERPINA3 (2)
- ADAMDEC1 (1)
- ADAMTS1 (1)
- ADAMTS5 (1)
- ALB (1)
- ANGPT2 (1)
- AZGP1 (1)
- BGN (1)
- CAMP (1)
- CD8A (1)
- CHGA (1)
- DBH (1)
- DCN (1)
- DKK1 (1)
- EGFR (1)
- F8 (1)
- FGF2 (1)
- FGF21 (1)
- FOLR1 (1)
- GAS6 (1)
- GHRH (1)
- GREM1 (1)
- IFNB1 (1)
- IL12A (1)
- IL17RB (1)
- IL1B (1)
- ISG15 (1)
- KLK5 (1)
- KLK7 (1)
- LAMB3 (1)
- LAMC1 (1)
- LIF (1)
- LOX (1)
- MGP (1)
- MSTN (1)
- NGF (1)
- NRP1 (1)
- PCOLCE (1)
- PDYN (1)
- PGF (1)
- PLA2G3 (1)
- PLAT (1)
- PLAUR (1)
- PTHLH (1)
- SCGB1A1 (1)
- SERPINB5 (1)
- SERPINE1 (1)
- SLPI (1)
- SPP1 (1)
- ST6GAL1 (1)
- SV2A (1)
- SYT7 (1)
- TFF1 (1)
- TIMP1 (1)
- TNFRSF11B (1)
- VEGFA (1)
- VGF (1)
- VTN (1)
- WFDC2 (1)
- WNT2 (1)
Reactivities
Antibody Hosts
Pathways
- Cytokine-cytokine receptor interaction (10)
- MAPK signaling pathway (8)
- Pathways in cancer (8)
- Focal adhesion (7)
- ECM-receptor interaction (5)
- Complement and coagulation cascades (4)
- Cytosolic DNA-sensing pathway (4)
- Toll-like receptor signaling pathway (4)
- Bladder cancer (3)
- Jak-STAT signaling pathway (3)
- Melanoma (3)
- Metabolic pathways (3)
- NOD-like receptor signaling pathway (3)
- Neurotrophin signaling pathway (3)
- Pancreatic cancer (3)
- RIG-I-like receptor signaling pathway (3)
- Regulation of actin cytoskeleton (3)
- Apoptosis (2)
- GnRH signaling pathway (2)
- Hematopoietic cell lineage (2)
- Huntington's disease (2)
- Prion diseases (2)
- Renal cell carcinoma (2)
- Small cell lung cancer (2)
- Type I diabetes mellitus (2)
- VEGF signaling pathway (2)
- Wnt signaling pathway (2)
- mTOR signaling pathway (2)
- p53 signaling pathway (2)
- Adherens junction (1)
- Allograft rejection (1)
- Alzheimer's disease (1)
- Antigen processing and presentation (1)
- Arachidonic acid metabolism (1)
- Axon guidance (1)
- Basal cell carcinoma (1)
- Calcium signaling pathway (1)
- Cell adhesion molecules (CAMs) (1)
- Colorectal cancer (1)
- Dorso-ventral axis formation (1)
- Endocytosis (1)
- Endometrial cancer (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- ErbB signaling pathway (1)
- Ether lipid metabolism (1)
- Fc epsilon RI signaling pathway (1)
- Gap junction (1)
- Glioma (1)
- Glycerophospholipid metabolism (1)
- Graft-versus-host disease (1)
- Hedgehog signaling pathway (1)
- Linoleic acid metabolism (1)
- Long-term depression (1)
- Melanogenesis (1)
- N-Glycan biosynthesis (1)
- Natural killer cell mediated cytotoxicity (1)
- Non-small cell lung cancer (1)
- Primary immunodeficiency (1)
- Prostate cancer (1)
- T cell receptor signaling pathway (1)
- TGF-beta signaling pathway (1)
- Tyrosine metabolism (1)
- Vascular smooth muscle contraction (1)
- alpha-Linolenic acid metabolism (1)