Germany
Japan
United Kingdom
China
Antibodies
View as table Download
GLG1 / MG160 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | GLG1 / MG160 antibody was raised against synthetic 18 amino acid peptide from internal region of human GLG1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Opossum, Turkey, Chicken, Xenopus, Zebrafish (100%); Stickleback (89%). |
Rabbit polyclonal beta Catenin antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus. |
Rabbit polyclonal TUBB2B Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TUBB2B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-39 amino acids from the N-terminal region of human TUBB2B. |
Rabbit polyclonal HAND2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HAND2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 81-110 amino acids from the Central region of human HAND2. |
Rabbit polyclonal MAPK1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human MAPK1. |
Rabbit Polyclonal antibody to TCP1 theta (chaperonin containing TCP1, subunit 8 (theta))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 111 and 367 of TCP1 theta (Uniprot ID#P50990) |
Rabbit Polyclonal antibody to O-GlcNAc transferase (O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 280 of O-GlcNAc transferase (Uniprot ID#O15294) |
KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Dog, Pig |
| Conjugation | Unconjugated |
| Immunogen | KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Dog, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Chicken, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | PGES / PTGES antibody was raised against synthetic 14 amino acid peptide from near N-terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Rat, Bovine, Dog, Elephant, Panda, Rabbit, Horse, Pig, Opossum, Turkey, Chicken, Platypus, Pufferfish, Zebrafish, Stickleback (100%); Mouse, Xenopus, Pike (93%). |
WNT7A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%). |
Rabbit polyclonal anti-SMAD3 antibody
| Applications | IHC, WB |
| Reactivities | Human, Xenopus, Xenopus Tropicalis, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of human SMAD3 protein. |
Rabbit polyclonal anti-Pdcd4 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding amino acids near the carboxyl terminus of human Pdcd4 protein. |
Rabbit polyclonal Pdcd4 phospho S457 antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids surrounding Ser457 in the human Pdcd4 protein. |
| Modifications | Phospho-specific |
Rabbit polyclonal CKII alpha (CSNK2A1) Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CKII alpha (CSNK2A1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 240-269 amino acids from the Central region of human CKII alpha (CSNK2A1). |
Rabbit polyclonal Protein Phosphatase 1 beta (PPP1CB) Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Protein Phosphatase 1 beta (PPP1CB) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-315 amino acids from the C-terminal region of human Protein Phosphatase 1 beta (PPP1CB). |
Rabbit Polyclonal Anti-Egr1 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Egr1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQV |
Rabbit polyclonal antibody to ING5 (inhibitor of growth family, member 5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 46 and 142 of ING5 (Uniprot ID#Q8WYH8) |
Rabbit polyclonal antibody to Axin 1 (axin 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 800 and 862 of AXIN1 (Uniprot ID#O15169) |
Rabbit Anti-Polo-Like Kinase Kinase (Ser482,486,490) Antibody (Phospho-Specific)
| Reactivities | Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser482/486/490 conjugated to KLH |
| Modifications | Phospho-specific |
GLG1 / MG160 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Chimpanzee, Chicken, Dog, Xenopus, Guinea pig, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | GLG1 / MG160 antibody was raised against synthetic 19 amino acid peptide from internal region of human GLG1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Lizard, Xenopus (100%); Hamster (95%); Stickleback, Medaka, Pufferfish, Zebrafish (84%). |
KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Horse, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
TNIK Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Chicken, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | TNIK antibody was raised against synthetic 18 amino acid peptide from internal region of human TNIK. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Opossum, Chicken, Lizard (100%); Xenopus (94%). |
Rabbit polyclonal anti-PCNA antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Fish, Human, Monkey, Mouse, Rat, Xenopus, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PCNA protein. |
Rabbit polyclonal SDHA Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SDHA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 577-605 amino acids from the C-terminal region of human SDHA. |
Rabbit Polyclonal anti-RAD17 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD17 antibody: synthetic peptide directed towards the C terminal of human RAD17. Synthetic peptide located within the following region: PTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT |
Rabbit Polyclonal anti-RAD17 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD17 antibody: synthetic peptide directed towards the N terminal of human RAD17. Synthetic peptide located within the following region: MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF |
Rabbit Polyclonal Anti-KIF22 Antibody
| Applications | WB |
| Reactivities | Human, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIF22 antibody: synthetic peptide directed towards the N terminal of human KIF22. Synthetic peptide located within the following region: CSLEIANWRNHQETLKYQFDAFYGERSTQQDIYAGSVQPILRHLLEGQNA |
Rabbit Polyclonal Anti-TPX2 Antibody
| Applications | WB |
| Reactivities | Human, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPX2 antibody: synthetic peptide directed towards the C terminal of human TPX2. Synthetic peptide located within the following region: LSGSLVQEPFQLATEKRAKERQELEKRMAEVEAQKAQQLEEARLQEEEQK |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Xenopus
Isotypes
- IgG
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- Druggable Genome
Filter by
Target Symbol
- GLG1 (2)
- H2AFZ (2)
- HPRT1 (2)
- KCNMA1 (2)
- PDCD4 (2)
- RAD17 (2)
- SMAD3 (2)
- ADAMTS1 (1)
- ALAS2 (1)
- ALDH1A2 (1)
- ATG5 (1)
- ATR (1)
- AXIN1 (1)
- CALCRL (1)
- CAPN5 (1)
- CCT8 (1)
- CKB (1)
- CKS2 (1)
- CLCN5 (1)
- CSNK2A1 (1)
- CTNNB1 (1)
- DEDD (1)
- DTX1 (1)
- EGR1 (1)
- EIPR1 (1)
- EN2 (1)
- ENO1 (1)
- EPS8 (1)
- FOXG1 (1)
- GIPC1 (1)
- GLDC (1)
- GLI3 (1)
- HAND2 (1)
- HDAC1 (1)
- HRAS (1)
- ING5 (1)
- IPO7 (1)
- ITPA (1)
- KIF22 (1)
- MAP2K4 (1)
- MAPK1 (1)
- MIB1 (1)
- MMP2 (1)
- NCS1 (1)
- NEK7 (1)
- NPR3 (1)
- NR2F1 (1)
- OGT (1)
- OSGEP (1)
- PCCB (1)
- PCNA (1)
- PFKM (1)
- PIK3C3 (1)
- PLK1 (1)
- PPP1CB (1)
- PPP1CC (1)
- PPP3CB (1)
- PRPS2 (1)
- PSMB8 (1)
- PTGES (1)
- RAB6A (1)
- RAC1 (1)
- RFC4 (1)
- SAT1 (1)
- SDHA (1)
- STK24 (1)
- STK26 (1)
- TBCK (1)
- TBP (1)
- TMEM147 (1)
- TNIK (1)
- TPX2 (1)
- TUBB (1)
- TUBB2B (1)
- TUBB4A (1)
- WNT7A (1)
- XPR1 (1)
Antibody Hosts
Modifications
Pathways
- Metabolic pathways (16)
- Pathways in cancer (11)
- Wnt signaling pathway (8)
- Adherens junction (6)
- Cell cycle (6)
- Colorectal cancer (6)
- Focal adhesion (6)
- Vascular smooth muscle contraction (6)
- Chronic myeloid leukemia (5)
- Gap junction (5)
- Long-term potentiation (5)
- MAPK signaling pathway (5)
- Oocyte meiosis (5)
- Regulation of actin cytoskeleton (5)
- Axon guidance (4)
- B cell receptor signaling pathway (4)
- Basal cell carcinoma (4)
- Endometrial cancer (4)
- Fc epsilon RI signaling pathway (4)
- GnRH signaling pathway (4)
- Insulin signaling pathway (4)
- Melanogenesis (4)
- Natural killer cell mediated cytotoxicity (4)
- Pancreatic cancer (4)
- Pathogenic Escherichia coli infection (4)
- Purine metabolism (4)
- VEGF signaling pathway (4)
- Alzheimer's disease (3)
- Bladder cancer (3)
- Chemokine signaling pathway (3)
- Drug metabolism - other enzymes (3)
- ErbB signaling pathway (3)
- Huntington's disease (3)
- Leukocyte transendothelial migration (3)
- Neurotrophin signaling pathway (3)
- Prostate cancer (3)
- Renal cell carcinoma (3)
- T cell receptor signaling pathway (3)
- TGF-beta signaling pathway (3)
- Thyroid cancer (3)
- Tight junction (3)
- Toll-like receptor signaling pathway (3)
- Acute myeloid leukemia (2)
- Amyotrophic lateral sclerosis (ALS) (2)
- Arginine and proline metabolism (2)
- Cell adhesion molecules (CAMs) (2)
- DNA replication (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- Fc gamma R-mediated phagocytosis (2)
- Glioma (2)
- Glycine (2)
- Glycolysis / Gluconeogenesis (2)
- Hedgehog signaling pathway (2)
- Long-term depression (2)
- Melanoma (2)
- Mismatch repair (2)
- Non-small cell lung cancer (2)
- Notch signaling pathway (2)
- Nucleotide excision repair (2)
- Pentose phosphate pathway (2)
- Prion diseases (2)
- Progesterone-mediated oocyte maturation (2)
- Regulation of autophagy (2)
- Systemic lupus erythematosus (2)
- serine and threonine metabolism (2)
- Apoptosis (1)
- Arachidonic acid metabolism (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Basal transcription factors (1)
- Base excision repair (1)
- Calcium signaling pathway (1)
- Citrate cycle (TCA cycle) (1)
- Dorso-ventral axis formation (1)
- Endocytosis (1)
- Fructose and mannose metabolism (1)
- Galactose metabolism (1)
- Inositol phosphate metabolism (1)
- NOD-like receptor signaling pathway (1)
- Neuroactive ligand-receptor interaction (1)
- O-Glycan biosynthesis (1)
- Oxidative phosphorylation (1)
- Parkinson's disease (1)
- Phosphatidylinositol signaling system (1)
- Porphyrin and chlorophyll metabolism (1)
- Propanoate metabolism (1)
- Proteasome (1)
- Pyrimidine metabolism (1)
- RIG-I-like receptor signaling pathway (1)
- RNA degradation (1)
- Retinol metabolism (1)
- Type II diabetes mellitus (1)
- Valine (1)
- Viral myocarditis (1)
- leucine and isoleucine degradation (1)
- mTOR signaling pathway (1)
- p53 signaling pathway (1)