TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Antibody against GLUT1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of the human GLUT1 protein (between residues 1-100). [Swiss-Prot #P11166] |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
Modifications | Phospho-specific |
Rabbit Polyclonal PPARGC1A Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit polyclonal antibody to CaMKK beta (calcium/calmodulin-dependent protein kinase kinase 2, beta)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 498 of CaMKK beta |
Rabbit polyclonal IRS-1 (Ab-312) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Rabbit polyclonal anti-PGC-1alpha antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
Modifications | Phospho-specific |
Rabbit anti-CPT1A Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CPT1A |
Rabbit Polyclonal Anti-IRS1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IRS1 |
Neuropeptide Y (NPY) (68-97) rabbit polyclonal antibody, Serum
Applications | IF, IHC |
Reactivities | Human, Rat |
Immunogen | Synthetic Prepro-NPY 68-97 (C-PON). |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
Modifications | Phospho-specific |
Rabbit anti-TNF-R1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TNF-R1 |
Rabbit Polyclonal Anti-PPARGC1A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS |
Rabbit Polyclonal Anti-ADIPOQ Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ADIPOQ |
Rabbit anti-IKBKG Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IKBKG |
NFKBIA Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NFKBIA |
Rabbit Polyclonal Anti-MALT1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | MALT1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human MALT1. |
Goat Polyclonal Antibody against CPT1A
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DPAQTVEQRLKLFK, from the internal region of the protein sequence according to NP_001867.2; NP_001027017.1. |
Rabbit anti-PPARGC1A polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human PGC-1. |
Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt |
Modifications | Phospho-specific |
Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4). |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
Modifications | Phospho-specific |
Rabbit anti-CHUK Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CHUK |
Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human sTNF Receptor Type I |
Rabbit Polyclonal Anti-PRKAA2 Antibody - middle region
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRKAA2 antibody: synthetic peptide directed towards the middle region of human PRKAA2. Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP |
Rabbit Polyclonal Antibody against CD36
Applications | IHC, WB |
Reactivities | Human, Bovine, Monkey |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide mapping to a region of human CD36 between residues 100-200. |
Rabbit polyclonal anti-GLUT1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human GLUT1. |
STK11 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human STK11 |
Rabbit polyclonal anti-TNFA antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNFA. |
Rabbit polyclonal JAK2 (Tyr570) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JAK2 around the phosphorylation site of tyrosine 750 (G-D-YP-G-Q). |
Modifications | Phospho-specific |
Rabbit Polyclonal IRS-1 (Ser307) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IRS-1 around the phosphorylation site of Serine 307 |
Modifications | Phospho-specific |
PRKAA1 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRKAA1 |
Anti-Human Leptin Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human Leptin |
USD 375.00
5 Days
Rabbit Polyclonal Anti-G6pc Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6pc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI |
Rabbit Polyclonal NFkB1/NFkB p105 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an N-terminal region of the human NFkB p105/p50 protein (within residues 400-590). [Swiss-Prot P19838] |
Rabbit Polyclonal Anti-LEP Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS |
Rabbit Polyclonal Anti-JAK2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | JAK2 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human JAK2. |
LKB1 (STK11) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Antibody against STAT3 (Phospho-STAT3-Y727 ) (Phospho-Specific)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This STAT3 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S727 of human STAT3. |
Modifications | Phospho-specific |
Rabbit anti-MTOR polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antibody was produced against synthesized non-phosphopeptide derived fromhuman mTOR around the phosphorylation site of serine 2448 (T-D-SP-Y-S). |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
Modifications | Phospho-specific |
Rabbit Polyclonal JNK1/2/3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Biotinylated Anti-Human Leptin Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human Leptin |
Rabbit Polyclonal Glut4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human Glucose Transporter GLUT4 protein (between residues 480-509) [UniProt P14672] |
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
Applications | WB |
Reactivities | Rat, Tobacco hornworm |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
Rabbit Polyclonal Antibody against AKT2 (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit Polyclonal Akt1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Akt1 antibody was raised against a 16 amino acid peptide from near the amino-terminus of human Akt1. |
Rabbit polyclonal Retinoid X Receptor gamma antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Retinoid X Receptor ? antibody. |