Germany
Japan
United Kingdom
China
SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126) |
Antibodies
DownloadRabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit Polyclonal antibody to Activin A Receptor type IIA (activin A receptor, type IIA)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 267 and 513 of Activin A Receptor type IIA (Uniprot ID#P27037) |
Anti-Human BCA-1 Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human BCA-1 (CXCL13) |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit Polyclonal Anti-TGFR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGFR2 Antibody: A synthesized peptide derived from human TGFR2 |
Goat Anti-IL18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NPPDNIKDTKSDI, from the internal region of the protein sequence according to NP_001553.1. |
CCR6 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | CCR6 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR6. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (94%); Monkey (89%); Opossum (83%). |
TNFSF9 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 50-100 of Human 4-1BBL. |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
IFNAR2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNAR2 |
Rabbit Polyclonal Anti-TNFSF14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFSF14 antibody: synthetic peptide directed towards the middle region of human TNFSF14. Synthetic peptide located within the following region: ATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFM |
Rabbit Polyclonal Anti-LEP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS |
CXCR4 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 310-360 of Human CXCR-4. |
Flt3 ligand (FLT3LG) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 180-230 of Human Flt3-L. |
IL5RA rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide, corresponding to amino acids 50-100 of Human IL-5Rα. |
Inhibin beta A (INHBA) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | This INHBA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 85-112 amino acids from the N-terminal region of human INHBA. |
PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) Recombinant Human PDGF-B. |
SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126) |
Goat Polyclonal Antibody against NGFR
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-AKREEVEKLLNG, from the internal region of the protein sequence according to NP_002498.1. |
Rabbit Polyclonal CCR5 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR5 antibody was raised against a 15 amino acid peptide near the amino terminus of human CCR5. The immunogen is located within the first 50 amino acids of CCR5. |
Rabbit Polyclonal antibody to interferon alpha Receptor 1 (interferon (alpha, beta and omega) receptor 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 3 and 240 of interferon alpha Receptor 1 (Uniprot ID#P17181) |
Active filters
Clonalities
- Polyclonal
Pathways
- Cytokine-cytokine receptor interaction
Filter by
Target Symbol
- EGFR (81)
- KDR (37)
- MET (23)
- CSF1R (22)
- PDGFRB (22)
- KIT (17)
- CXCL12 (16)
- CXCR4 (16)
- EGF (16)
- PDGFB (16)
- TNFSF11 (15)
- IL12A (14)
- IL17A (14)
- IL4 (14)
- KITLG (14)
- EPOR (13)
- IL2 (13)
- IL6 (13)
- NGFR (13)
- VEGFA (13)
- FLT1 (12)
- TNF (12)
- TNFRSF10B (12)
- TNFRSF11B (12)
- FAS (11)
- IL1B (11)
- IL7 (11)
- LEP (11)
- PDGFA (11)
- TNFRSF1A (11)
- TNFSF13 (11)
- CCL2 (10)
- CCL27 (10)
- CCR7 (10)
- CX3CR1 (10)
- FLT3 (10)
- IFNB1 (10)
- IL9 (10)
- TGFBR2 (10)
- ACVR1 (9)
- CCR5 (9)
- CD70 (9)
- FASLG (9)
- IFNG (9)
- PDGFRA (9)
- TGFB1 (9)
- TNFRSF1B (9)
- VEGFB (9)
- CCL28 (8)
- CCR8 (8)
- CD40 (8)
- CSF2 (8)
- CXCR2 (8)
- CXCR3 (8)
- EDA (8)
- IL10 (8)
- IL10RA (8)
- IL19 (8)
- IL21 (8)
- IL2RB (8)
- TGFB2 (8)
- TGFBR1 (8)
- TNFRSF11A (8)
- TNFSF10 (8)
- TSLP (8)
- CCR3 (7)
- CNTF (7)
- CSF1 (7)
- CX3CL1 (7)
- IL22 (7)
- PRL (7)
- TNFRSF25 (7)
- TNFSF12 (7)
- TNFSF13B (7)
- TNFSF14 (7)
- BMP2 (6)
- BMP7 (6)
- BMPR2 (6)
- CCL3 (6)
- CD40LG (6)
- CTF1 (6)
- CXCL1 (6)
- FLT4 (6)
- IFNAR1 (6)
- IFNL2 (6)
- IL18R1 (6)
- IL20 (6)
- IL22RA1 (6)
- IL23A (6)
- IL6ST (6)
- INHBA (6)
- TNFSF15 (6)
- TNFSF4 (6)
- ACVR1B (5)
- AMH (5)
- CCL11 (5)
- CCL20 (5)
- CCL5 (5)
- CCL7 (5)
- CCR1 (5)
Reactivities
Applications
Antibody Hosts
Conjugates
Modifications
Families
- Druggable Genome (1515)
- Transmembrane (997)
- Secreted Protein (838)
- ES Cell Differentiation/IPS (373)
- Protein Kinase (295)
- Adult stem cells (142)
- GPCR (108)
- Cancer stem cells (95)
- Stem cell relevant signaling - JAK/STAT signaling pathway (84)
- Embryonic stem cells (52)
- Transcription Factors (34)
- Induced pluripotent stem cells (33)
- Stem cell - Pluripotency (22)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (14)
- Protease (5)
- Stem cell relevant signaling - DSL/Notch pathway (3)