Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Antibody against CD14 (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 292-322 amino acids from the C-terminal region of human CD14. |
Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Drosophila, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 37 and 276 of alpha Tubulin 1A |
Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1 |
Rabbit Polyclonal antibody to alpha Tubulin (tubulin, alpha 1b)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 118 and 365 of alpha Tubulin (Uniprot ID#P68363) |
Rabbit polyclonal 14-3-3 zeta/delta (Ab-232) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human 14-3-3 ?/d around the phosphorylation site of threonine 232 (S-D-TP-Q-G) |
Rabbit polyclonal 14-3-3 zeta (Ser58) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human 14-3-3 ? around the phosphorylation site of serine 58 (R-S-SP-W-R) |
| Modifications | Phospho-specific |
Rabbit polyclonal Rho/Rac Guanine Nucleotide Exchange Factor 2 (Ser885) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Rho/Rac Guanine Nucleotide Exchange Factor 2 around the phosphorylation site of serine 885 (R-R-SP-L-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Ezrin (Phospho-Tyr478) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Ezrin around the phosphorylation site of tyrosine 478 (P-V-YP-E-P) |
| Modifications | Phospho-specific |
WAS Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human WAS |
Chicken Polyclonal Anti-Beta-actin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Beta-actin antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human beta-actin. |
Rabbit Polyclonal Anti-ACTIN Antibody
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of Arabidopsis thaliana actin |
Goat Polyclonal Anti-CDH1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 750 to 850 of human CDH1 produced in E. coli. |
USD 440.00
2 Weeks
Tubulin (TUBA1B) (427-441) (Loading Control) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to Amino acids 427-441 of Human alpha Tubulin. |
Rabbit Polyclonal Antibody against CD14 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human CD14. |
Rabbit Polyclonal MD-2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MD-2 antibody was raised against a peptide corresponding to 13 amino acids near the center of human MD-2. The immunogen is located within the last 50 amino acids of MD-2. |
Rabbit polyclonal p47 phox/NCF1 (Ab-345) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p47 phox around the phosphorylation site of serine 345 (P-Q-SP-P-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal NCF1/Neutrophil Cytosol Factor 1 (Ser304)(Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Neutrophil Cytosol Factor 1 around the phosphorylation site of serine 304 (R-S-SP-I-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal p47 phox/NCF1 (Ab-359) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p47 phox around the phosphorylation site of serine 359 (Q-R-SP-K-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal Shc (Tyr427) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 427 (P-S-YP-V-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal Shc (Ab-349) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 349 (H-Q-YP-Y-N). |
Rabbit polyclonal Cortactin (Tyr466) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Cortactin around the phosphorylation site of tyrosine 466 (P-V-YP-E-T). |
| Modifications | Phospho-specific |
Rabbit Anti-Human TLR5 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TLR5 antibody was raised against synthetic peptide from human TLR5. |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 177-189 amino acids of Human ras homolog family member A |
Rabbit polyclonal NCL Antibody (Center P291)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NCL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 276-304 amino acids from the Central region of human NCL. |
Rabbit polyclonal ARPC1A Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ARPC1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-315 amino acids from the C-terminal region of human ARPC1A. |
ARPC1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ARPC1A |
CLDN1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CLDN1 |
Rabbit anti-LY96 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LY96 |
Rabbit Polyclonal Anti-ARPC2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARPC2 antibody: synthetic peptide directed towards the N terminal of human ARPC2. Synthetic peptide located within the following region: MVLNVYCCFFQISDIQTMKINQTILKEFILVGFSVYPHVQTFLFVVFFCL |
Rabbit Polyclonal Anti-Tubb2a Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Tubb2a antibody is: synthetic peptide directed towards the C-terminal region of Mouse Tubb2a. Synthetic peptide located within the following region: RKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEE |
Rabbit Polyclonal Anti-PARVG Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PARVG antibody is: synthetic peptide directed towards the N-terminal region of Human PARVG. Synthetic peptide located within the following region: RKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAA |
Rabbit Polyclonal Anti-TUBA4A Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH |
Active filters
Clonalities
- Polyclonal
Pathways
- Pathogenic Escherichia coli infection
Filter by
Category
Target Symbol
- CTNNB1 (35)
- EZR (24)
- ABL1 (20)
- ACTB (20)
- CDH1 (17)
- CTTN (16)
- PRKCA (16)
- ROCK2 (15)
- YWHAZ (15)
- TLR4 (13)
- NCF1 (12)
- FYN (11)
- KRT18 (11)
- SHC1 (11)
- CLDN1 (10)
- TUBA4A (10)
- ITGB1 (9)
- TUBA1A (9)
- HCLS1 (8)
- ACTG1 (7)
- NCL (7)
- RHOA (7)
- YWHAQ (7)
- ARHGEF2 (6)
- ROCK1 (6)
- TLR5 (6)
- ARPC1A (5)
- ARPC3 (5)
- CD14 (5)
- CDC42 (5)
- LY96 (5)
- TUBA1B (5)
- TUBB (5)
- TUBB3 (5)
- WAS (5)
- ARPC1B (4)
- ARPC2 (4)
- NCK1 (4)
- TUBA1C (4)
- TUBA3C (4)
- TUBB2A (3)
- ARPC4 (2)
- NCK2 (2)
- TUBA3D (2)
- TUBB1 (2)
- TUBB2B (2)
- TUBB4A (2)
- TUBB6 (2)
- PARVG (1)
- TUBB4Q (1)
- TUBB8 (1)
- WASL (1)
Reactivities
- Human (330)
- Mouse (258)
- Rat (218)
- Bovine (20)
- Chicken (15)
- Dog (14)
- Monkey (13)
- Pig (11)
- Canine (9)
- Cow (8)
- Canis (6)
- Rhesus Monkey (6)
- Rabbit (5)
- Xenopus (5)
- Chimpanzee (4)
- Drosophila (3)
- Porcine (3)
- Zebrafish (3)
- Hamster (2)
- Sheep (2)
- X. tropicalis (2)
- Avian (1)
- Bat (1)
- Feline (1)
- Guinea Pig (1)
- Horse (1)
- Primate (1)