Germany
Japan
United Kingdom
China
Rabbit anti-BUB1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BUB1 |
Antibodies
View as table Download
Anti-Human IGF-I Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IGF-I |
Rabbit anti-AKT1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT1 |
Rabbit Polyclonal Anti-CCNB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCNB3 antibody: synthetic peptide directed towards the C terminal of human CCNB3. Synthetic peptide located within the following region: ISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDMLKLE |
Rabbit Polyclonal Anti-HSP90AA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HSP90AA1 |
AKT1 (C-term) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
Rabbit polyclonal HSP90B (Ab-254) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
Rabbit polyclonal Cyclin B1 (Ab-126) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin B1 around the phosphorylation site of serine 126 (T-A-S-P-S). |
Rabbit polyclonal Raf1 (Ab-621) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P). |
Rabbit polyclonal Akt (Ab-129) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A). |
Rabbit polyclonal Akt (Ab-326) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R). |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-PDE3B antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 948 of mouse PDE3B. |
Rabbit Polyclonal Akt (Thr308) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Akt around the phosphorylation site of Threonine 308 |
| Modifications | Phospho-specific |
Rabbit polyclonal B-RAF (Phospho-Ser446) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human B-RAF around the phosphorylation site of serine 446 (R-D-SP-S-D). |
| Modifications | Phospho-specific |
AKT2 Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT2 |
Rabbit anti-PDE4D Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDE4D |
CDC25C Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC25C |
Rabbit anti-Phospho-AKT1/2/3-Y315/316/312 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y315/316/312 of human AKT1/AKT2/AKT3 |
Rabbit anti-MAPK14 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human MAPK14 |
Rabbit anti-IGF1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human IGF1 |
Rabbit Polyclonal Anti-PI3 kinase P110a Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PI3 kinase P110a Antibody: A synthesized peptide derived from human PI3 kinase P110a |
Rabbit Polyclonal Anti-Phospho-p38 MAPK (Thr180/Tyr182) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-p38 MAPK (Thr180/Tyr182) Antibody: A synthesized peptide derived from human p38 MAPK around the phosphorylation site of Thr180/Tyr182) . |
| Modifications | Phospho-specific |
MEK1 (MAP2K1) (N-term) rabbit polyclonal antibody, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Xenopus |
| Immunogen | MAP2K1 antibody was raised against synthetic peptide derived from sequence near the amino-terminus of human MEK1, conjugated to KLH |
USD 450.00
In Stock
Rabbit Polyclonal Antibody against PIK3CG (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 518-547 amino acids from the Central region of human PI3KCG. |
Goat Polyclonal Antibody against PDE5A
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-LINGESGQAKRN, from the C Terminus of the protein sequence according to NP_001074; NP_237223; NP_246273; (NP_236914). |
Rabbit Polyclonal antibody to PIK3R3 (phosphoinositide-3-kinase, regulatory subunit 3 (gamma))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 192 and 427 of PIK3R3 |
Rabbit polyclonal CDC16/APC6 (Ab-560) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC16/APC6 around the phosphorylation site of serine 560 (I-I-SP-P-P). |
Rabbit polyclonal AKT1/2/3 (Ab-315/316/312) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human AKT1/2/3 around the phosphorylation site of tyrosine 315/316/312 (P-E-YP-L-A). |
Rabbit polyclonal IGF1R (Ab-1346) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal Cyclin B1 (Ser147) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Cyclin B1 around the phosphorylation site of serine 147 (A-F-SP-D-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal Raf1 (Tyr341) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Raf1 around the phosphorylation site of tyrosine 341 (S-Y-YP-W-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal CDK1/CDC2 (Thr14) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDK1/CDC2 around the phosphorylation site of threonine 14 (E-G-TP-Y-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal Akt (Thr450) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human AKT1 around the phosphorylation site of threonine 450 (T-I-TP-P-P). |
| Modifications | Phospho-specific |
Active filters
Clonalities
- Polyclonal
Pathways
- Progesterone-mediated oocyte maturation
Filter by
Category
Target Symbol
- AKT1 (61)
- RAF1 (27)
- MAP2K1 (26)
- MAPK14 (25)
- CDC25A (24)
- CCNB1 (22)
- MAPK8 (21)
- CDK1 (20)
- BRAF (19)
- IGF1R (19)
- HSP90AB1 (17)
- MAPK3 (15)
- MAPK1 (14)
- PIK3R1 (14)
- AKT2 (13)
- IGF1 (13)
- RPS6KA1 (13)
- CDK2 (10)
- HSP90AA1 (10)
- CCNA1 (9)
- CDC16 (9)
- CDC25B (9)
- MAD2L1 (9)
- PDE4D (9)
- PGR (9)
- PLK1 (9)
- AKT3 (8)
- ANAPC1 (8)
- CDC25C (8)
- CDC27 (8)
- INS (8)
- PRKACA (8)
- BUB1 (6)
- CCNA2 (6)
- CDC23 (6)
- SKP2 (6)
- ANAPC10 (5)
- ANAPC5 (5)
- CCNB2 (5)
- MAPK9 (5)
- PDE1B (5)
- PDE4B (5)
- PDE7B (5)
- PIK3CA (5)
- SPDYA (5)
- ADCY1 (4)
- ADCY4 (4)
- ADCY5 (4)
- ARAF (4)
- CDC2 (4)
- MAPK10 (4)
- MAPK12 (4)
- PDE11A (4)
- PDE3A (4)
- PDE9A (4)
- PIK3CB (4)
- PIK3CG (4)
- PIK3R3 (4)
- PKMYT1 (4)
- PRKACB (4)
- RPS6KA2 (4)
- ADCY2 (3)
- ADCY6 (3)
- ANAPC13 (3)
- ANAPC4 (3)
- ANAPC7 (3)
- CCNB3 (3)
- CDC26 (3)
- CPEB1 (3)
- GNAI1 (3)
- GNAI2 (3)
- GNAI3 (3)
- MOS (3)
- PDE1A (3)
- PDE1C (3)
- PDE3B (3)
- PDE4C (3)
- PDE5A (3)
- PDE7A (3)
- PDE8A (3)
- PDE8B (3)
- PIK3CD (3)
- PRKACG (3)
- PRKX (3)
- RPS6KA6 (3)
- ADCY3 (2)
- ADCY8 (2)
- ANAPC11 (2)
- MAPK11 (2)
- PDE2A (2)
- PIK3R5 (2)
- RPS6KA3 (2)
- ADCY7 (1)
- ADCY9 (1)
- ANAPC2 (1)
- FZR1 (1)
- KRAS (1)
- MAD2L2 (1)
- MAPK13 (1)
- PDE4A (1)
Reactivities
- Human (575)
- Mouse (428)
- Rat (368)
- Bovine (28)
- Chicken (18)
- Dog (17)
- Monkey (17)
- Pig (9)
- Cow (8)
- Rabbit (7)
- Xenopus (7)
- Hamster (6)
- Drosophila (5)
- Canine (4)
- Primate (4)
- Gibbon (3)
- Gorilla (3)
- Horse (3)
- Rhesus Monkey (3)
- Zebrafish (3)
- Bat (2)
- Canis (2)
- Chimpanzee (2)
- Guinea Pig (2)
- Porcine (2)
- Sheep (2)
- C. elegans (1)
- Orang-Utan (1)
- Tobacco hornworm (1)