Germany
Japan
United Kingdom
China
Biotinylated Anti-Human IL-17E Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-17E |
Antibodies
Download
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Mouse Anti-Human IL-1 beta Purified (50 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 380.00
In Stock
Rabbit Polyclonal Anti-AMH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG |
Rabbit Polyclonal Anti-IL-12A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A. |
Rabbit Polyclonal Anti-Interleukin 12A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 12A Antibody: A synthesized peptide derived from human Interleukin 12A |
USD 379.00
In Stock
Anti-Human BCA-1 Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human BCA-1 (CXCL13) |
Goat Anti-IL18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NPPDNIKDTKSDI, from the internal region of the protein sequence according to NP_001553.1. |
IL-17 Mouse Monoclonal (aa1-75) (4K5F6) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TNFSF14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFSF14 antibody: synthetic peptide directed towards the middle region of human TNFSF14. Synthetic peptide located within the following region: ATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFM |
Rabbit Polyclonal Anti-LEP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS |
Mouse Monoclonal Anti-IL-2 Antibody [Clone ID: B-G5]
| Reactivities | Human |
| Conjugation | Unconjugated |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
| Applications | ELISA, FN, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Human
Conjugates
- Unconjugated
Families
- Secreted Protein
Pathways
- Cytokine-cytokine receptor interaction
Filter by
Target Symbol
- EGFR (122)
- IL6 (122)
- IL17A (98)
- CD40 (76)
- TNF (39)
- CSF2 (38)
- CSF3 (38)
- AMH (36)
- VEGFA (35)
- IL1A (29)
- IL20 (29)
- IFNG (27)
- PRL (27)
- TNFRSF18 (26)
- IL2 (22)
- CCL2 (20)
- CSF1 (20)
- CSF2RA (18)
- FLT1 (18)
- IL24 (18)
- IL25 (18)
- TGFB1 (17)
- CXCL8 (16)
- IL1B (16)
- VEGFB (16)
- IL4 (15)
- FAS (14)
- IL12A (14)
- IL15RA (14)
- VEGFD (14)
- EPOR (13)
- IL12B (12)
- IL17B (12)
- CCL19 (11)
- IL10 (11)
- IL3 (11)
- CCL5 (10)
- IL15 (10)
- LEP (10)
- TNFRSF11B (10)
- TNFSF13B (10)
- TNFSF13 (9)
- CCL11 (8)
- CCL3 (8)
- EPO (8)
- FASLG (8)
- TGFB2 (8)
- TNFRSF1A (8)
- CX3CL1 (7)
- EDA (7)
- GH2 (7)
- IFNL1 (7)
- IL13 (7)
- IL5 (7)
- TNFRSF1B (7)
- TNFSF14 (7)
- CCL20 (6)
- CRLF2 (6)
- CXCL1 (6)
- CXCL12 (6)
- IL21 (6)
- IL7 (6)
- IL9 (6)
- OSM (6)
- CCL7 (5)
- CD40LG (5)
- CXCL14 (5)
- FLT3LG (5)
- GH1 (5)
- IFNA2 (5)
- IFNB1 (5)
- INHBA (5)
- LIF (5)
- VEGFC (5)
- BMP2 (4)
- CCL16 (4)
- CCL28 (4)
- CSF3R (4)
- CTF1 (4)
- CXCL13 (4)
- IFNA6 (4)
- IFNL3 (4)
- IL18 (4)
- IL22 (4)
- IL23A (4)
- IL6ST (4)
- PPBP (4)
- TGFB3 (4)
- BMP7 (3)
- CCL1 (3)
- CCL17 (3)
- CCL21 (3)
- CCL23 (3)
- CCL26 (3)
- CCL8 (3)
- CXCL10 (3)
- CXCL16 (3)
- CXCL2 (3)
- CXCL3 (3)
- CXCL5 (3)