Rabbit Polyclonal Anti-IFNG Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IFNG |
Rabbit Polyclonal Anti-IFNG Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IFNG |
Rabbit Polyclonal Anti-Insulin Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Insulin Antibody: A synthesized peptide derived from human Insulin |
USD 379.00
In Stock
lFN-g Capture mouse monoclonal antibody, ELISA and Luminex validated, clone B140
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700016 |
Mouse monoclonal Insulin antibody
Applications | Dot, ELISA |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Interferon gamma Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interferon gamma Antibody: A synthesized peptide derived from human Interferon gamma |
Goat Polyclonal Anti-INS Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human Insulin produced in E. coli as a fusion protein. |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 315, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to interferon alpha 2 (interferon, alpha 2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 125 and 188 of Interferon alpha 2 (Uniprot ID#P01563) |
Anti-Human IFN-? Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IFN-γ |
Rabbit anti-IFNG Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IFNG |
Insulin (INS) rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Bovine, Porcine, Rat |
Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone GC8
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone GF1
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 165, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to interferon alpha 8 (interferon, alpha 8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 189 of interferon alpha 8 (Uniprot ID#P32881) |
Mouse Monoclonal Anti-IFN-gamma Antibody
Reactivities | Human, Rhesus Macaque |
Conjugation | Unconjugated |
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 3A6
Applications | ELISA |
Reactivities | Bovine, Human, Porcine |
Conjugation | Unconjugated |
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 7F8
Applications | ELISA |
Conjugation | Unconjugated |
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 8E2
Applications | ELISA |
Reactivities | Bovine, Human, Porcine |
Conjugation | Unconjugated |
Insulin (INS) (beta chain) mouse monoclonal antibody, clone C7C9
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 23, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to Interferon alpha-6 (interferon, alpha 6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 125 and 189 of interferon alpha 6 (Uniprot ID#P05013) |
Rabbit polyclonal IFNA4 Antibody (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IFNA4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 162-189 amino acids from the C-terminal region of human IFNA4. |
Biotinylated Anti-Human IFN-? Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IFN-γ |
Rabbit Polyclonal Anti-IFNA7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IFNA7 Antibody: synthetic peptide directed towards the N terminal of human IFNA7. Synthetic peptide located within the following region: RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ |
Rabbit Polyclonal Anti-IFNA5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IFNA5 antibody: synthetic peptide directed towards the middle region of human IFNA5. Synthetic peptide located within the following region: TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY |
Rabbit Polyclonal Anti-IFNA16 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IFNA16 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNA16. Synthetic peptide located within the following region: ILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD |
Rabbit Polyclonal Anti-IFNA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IFNA4 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNA4. Synthetic peptide located within the following region: ILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD |
Mouse Monoclonal Anti-IFN-gamma Antibody, Biotin conjugated
Reactivities | Human, Rhesus Macaque |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-IFN-gamma Antibody, FITC conjugated
Reactivities | Human, Rhesus Macaque |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-IFN-gamma Antibody
Reactivities | Human, Rhesus Macaque |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IFN-gamma Antibody
Reactivities | Human, Rhesus Macaque |
Conjugation | Unconjugated |
Immunogen | For immunization recombinant human IFN-gamma (E.coli-derived) is used |
Rabbit Polyclonal Anti-IFN-gamma Antibody, Biotin conjugated
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | For immunization recombinant human IFN-gamma (E.coli-derived) is used |
Mouse Monoclonal Anti-IFN-gamma Antibody,Biotin conjugated
Reactivities | Rhesus Macaque, Cynomolgus Monkey, Human, Chimpanzee |
Conjugation | Unconjugated |
Mouse monoclonal Anti-INFa Clone ST29
Reactivities | Human |
Conjugation | Unconjugated |
Mouse anti Insulin Monoclonal Antibody
Applications | IHC |
Reactivities | Human, Rat, Pig |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) IFNG mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) IFNG mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IFNG mouse monoclonal antibody, clone OTI4D7 (formerly 4D7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) IFNA6 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) IFNA2 mouse monoclonal antibody,clone OTI12C7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-INS Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human INS |
Rabbit Polyclonal Anti-IFNA16 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IFNA16 |
Rabbit Polyclonal Anti-IFNA2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IFNA2 |
IFNG mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IFNG mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IFNG mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IFNG mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IFNG mouse monoclonal antibody, clone OTI4D7 (formerly 4D7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IFNG mouse monoclonal antibody, clone OTI4D7 (formerly 4D7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |