Germany
Japan
United Kingdom
China
Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
| Applications | IHC, WB |
| Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Mouse monoclonal Hsp70/Hsc70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Beluga, Canine, Chicken, Drosophila, Fish, Guinea pig, Hamster, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
Rabbit polyclonal Hsp70 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Beluga, Cow, Dog, Fish (carp), Guinea Pig, Hamster, Monkey, Pig, Sheep, Coral, Tomato, Tobacco, Spiny Dogfish Shark (Squalus acanthias), Atlantic Hagfish (Myxine glutinosa) |
| Conjugation | Unconjugated |
| Immunogen | Full length human protein Hsp70 |
Rabbit polyclonal p38 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Pig |
| Conjugation | Unconjugated |
| Immunogen | A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. |
Rabbit Anti-DOPA Decarboxylase, Human Antibody
| Applications | WB |
| Reactivities | Bovine, Dog, Guinea Porcine, Human, Rabbit, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
USD 425.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
OLFM4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | OLFM4 / Olfactomedin 4 antibody was raised against synthetic 16 amino acid peptide from internal region of human OLFM4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset (100%); Guinea pig (94%); Orangutan, Rat, Hamster, Dog, Rabbit (88%); Galago, Mouse, Panda, Horse (81%). |
Rabbit Polyclonal MUC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal Antibody against VEGFA
| Applications | WB |
| Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Mouse Monoclonal Neurofibromin 1 Antibody (McNFn27b)
| Applications | IHC |
| Reactivities | Guinea Pig, Human, Mouse, Rat |
| Conjugation | Unconjugated |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%). |
Rabbit Polyclonal Anti-PTBP1 Antibody
| Applications | WB |
| Reactivities | Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Dog, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI |
NSE (ENO2) mouse monoclonal antibody, clone 5E2
| Applications | ELISA, IHC, WB |
| Reactivities | Guinea Pig, Human |
| Conjugation | Unconjugated |
NOS1 (1419-1433) rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Feline, Guinea Pig, Human, Mouse, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | C-terminal synthetic peptide sequence corresponding to amino acids (1419-1433) of human nNos coupled to KLH. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-UBB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | Native bovine Ubiquitin, conjugated to KLH |
GluT-1 / GLAST Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | SLC1A3 / GluT-1 / GLAST antibody was raised against synthetic 19 amino acid peptide from cytoplasmic domain of human SLC1A3 / GLAST. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Bovine, Horse, Rabbit, Pig (100%); Panda, Dog, Opossum, Guinea pig, Turkey, Chicken (95%); Xenopus (84%). |
Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665] |
Rabbit Polyclonal Anti-HTR1F Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HTR1F / 5-HT1F Receptor antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human 5HT1F Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Bovine, Rabbit (100%); Mouse, Elephant, Panda, Bat, Guinea pig (95%); Platypus (84%). |
USD 370.00
2 Weeks
Neurokinin 3 Receptor NK3 (TACR3) (C-term) rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Guinea Pig, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal antibody to RAMP1 (receptor (G protein-coupled) activity modifying protein 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 84 and 148 of RAMP1 (Uniprot ID#O60894) |
Rabbit polyclonal antibody to GIRK1 (potassium inwardly-rectifying channel, subfamily J, member 3)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 248 and 501 of GIRK1 (Uniprot ID#P48549) |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
TM9SF3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chimpanzee, Chicken, Guinea Pig, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | TM9SF3 antibody was raised against synthetic 15 amino acid peptide from internal region of human TM9SF3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Xenopus (100%); Lizard, Stickleback, Medaka (93%); Bat, Salmon, Zebrafish, Eye worm, Tick (87%); Pufferfish, Drosophila, Water flea, Nematode (80%). |
WNT7A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%). |
KCNH2 / HERG Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | KCNH2 / HERG antibody was raised against synthetic 16 amino acid peptide from internal region of human KCNH2 / Kv11.1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Bat, Guinea pig (94%). |
Rat Monoclonal Anti-TCP1 alpha Antibody
| Applications | WB |
| Reactivities | Mouse, Rat, Rabbit, Guinea pig, Hamster, Cow, Dog, Human, Pig, Saccharomyces cerevisiae, Caenorhabditis elegans, Fruit fly (Drosophila melanogaster), Monkey |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FAM86A Antibody
| Applications | WB |
| Reactivities | Guinea Pig, Human, Rat, Dog, Horse, Cow |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM86A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM86A. Synthetic peptide located within the following region: CREHQRAPEVYVAFTVRNPETCQLFTTELGRAGIRWEVEPRHEQKLFPYE |
Rabbit Polyclonal Anti-TSHR Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TSH Receptor / TSHR antibody was raised against synthetic 19 amino acid peptide from C-terminus of human TSH Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Bat, Dog, Elephant, Horse, Pig, Guinea pig (94%); Mouse, Rat, Sheep, Cat, Bovine, Hamster, Panda, Rabbit, Opossum (89%). |
Rabbit Polyclonal Anti-FSHR Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | FSH Receptor / FSHR antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human FSHR. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset (100%); Gibbon, Dog, Bat, Elephant, Rabbit, Horse, Pig, Guinea pig (94%); Bovine, Cat, Goat (88%); Mouse, Rat, Sheep (82%). |
Rabbit anti Actin, skeletal muscle Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Rabbit, GP |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of human alpha skeletal muscle isoforms of actin. This sequence is identical in human, rat, mouse, dog, bovine, guinea pig, sheep and frog origins. |
Active filters
Reactivities
- Guinea Pig
Conjugates
- Unconjugated
Filter by
Target Symbol
- CANX (5)
- GCG (5)
- HSPA1A (4)
- CD79A (2)
- GLG1 (2)
- HRH3 (2)
- HSPA8 (2)
- HSPD1 (2)
- HTR1F (2)
- PDIA3 (2)
- SNAP25 (2)
- SOD2 (2)
- SYNTAXIN (2)
- ACTA1 (1)
- ACTB (1)
- ADRA1A (1)
- AKT2 (1)
- ATP1B3 (1)
- CALCRL (1)
- CALR (1)
- CCKAR (1)
- CD3E (1)
- CD5 (1)
- CHRM3 (1)
- DCXR (1)
- DDC (1)
- EEF2KMT (1)
- FSHR (1)
- GPX4 (1)
- HIF1A (1)
- HSF1 (1)
- HSF2 (1)
- HSP90B1 (1)
- HSPE1 (1)
- KCNH2 (1)
- KCNJ3 (1)
- KCNJ6 (1)
- MAOB (1)
- MAPK14 (1)
- MBP (1)
- MUC1 (1)
- NF1 (1)
- NORMAL GUINEA PIG SERUM (1)
- NPY (1)
- NQO1 (1)
- OLFM4 (1)
- PCK2 (1)
- PTBP1 (1)
- PTGES3 (1)
- RAMP1 (1)
- SLC1A3 (1)
- SLC4A2 (1)
- TACR1 (1)
- TCP1 (1)
- TM9SF3 (1)
- TSHR (1)
- TUBA1A (1)
- UBB (1)
- VEGFA (1)
- WNT2 (1)
- WNT7A (1)
Antibody Hosts
Clonalities
Assay Types
Families
- Druggable Genome (50)
- Transmembrane (34)
- GPCR (8)
- Secreted Protein (6)
- Stem cell - Pluripotency (6)
- Transcription Factors (6)
- ES Cell Differentiation/IPS (5)
- Ion Channels: Potassium (3)
- Protein Kinase (2)
- Adult stem cells (1)
- Cancer stem cells (1)
- Nuclear Hormone Receptor (1)
- Stem cell relevant signaling - Wnt Signaling pathway (1)
Pathways
- Antigen processing and presentation (14)
- Neuroactive ligand-receptor interaction (11)
- MAPK signaling pathway (9)
- Endocytosis (6)
- Pathways in cancer (6)
- Spliceosome (6)
- Calcium signaling pathway (4)
- Metabolic pathways (4)
- Prion diseases (4)
- Adipocytokine signaling pathway (3)
- B cell receptor signaling pathway (3)
- Focal adhesion (3)
- Primary immunodeficiency (3)
- Renal cell carcinoma (3)
- T cell receptor signaling pathway (3)
- VEGF signaling pathway (3)
- Vascular smooth muscle contraction (3)
- mTOR signaling pathway (3)
- Basal cell carcinoma (2)
- Cell adhesion molecules (CAMs) (2)
- Fc epsilon RI signaling pathway (2)
- Hedgehog signaling pathway (2)
- Hematopoietic cell lineage (2)
- Histidine metabolism (2)
- Insulin signaling pathway (2)
- Leukocyte transendothelial migration (2)
- Melanogenesis (2)
- NOD-like receptor signaling pathway (2)
- Neurotrophin signaling pathway (2)
- Pancreatic cancer (2)
- Pathogenic Escherichia coli infection (2)
- Phenylalanine metabolism (2)
- Progesterone-mediated oocyte maturation (2)
- Prostate cancer (2)
- RNA degradation (2)
- Regulation of actin cytoskeleton (2)
- Tight junction (2)
- Toll-like receptor signaling pathway (2)
- Tryptophan metabolism (2)
- Type I diabetes mellitus (2)
- Tyrosine metabolism (2)
- Wnt signaling pathway (2)
- Acute myeloid leukemia (1)
- Adherens junction (1)
- Amyotrophic lateral sclerosis (ALS) (1)
- Apoptosis (1)
- Arginine and proline metabolism (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Autoimmune thyroid disease (1)
- Bladder cancer (1)
- Cardiac muscle contraction (1)
- Chemokine signaling pathway (1)
- Chronic myeloid leukemia (1)
- Citrate cycle (TCA cycle) (1)
- Colorectal cancer (1)
- Cytokine-cytokine receptor interaction (1)
- Dilated cardiomyopathy (1)
- Drug metabolism - cytochrome P450 (1)
- Endometrial cancer (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- ErbB signaling pathway (1)
- Fc gamma R-mediated phagocytosis (1)
- Gap junction (1)
- Glioma (1)
- Glycine (1)
- Glycolysis / Gluconeogenesis (1)
- GnRH signaling pathway (1)
- Huntington's disease (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Jak-STAT signaling pathway (1)
- Melanoma (1)
- Non-small cell lung cancer (1)
- PPAR signaling pathway (1)
- Parkinson's disease (1)
- Pentose and glucuronate interconversions (1)
- Pyruvate metabolism (1)
- RIG-I-like receptor signaling pathway (1)
- Small cell lung cancer (1)
- Vibrio cholerae infection (1)
- Viral myocarditis (1)
- serine and threonine metabolism (1)