Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit Polyclonal Anti-NEU1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG |
Rabbit polyclonal GC Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 337-365 amino acids from the Central region of human GC. |
Rabbit Polyclonal Anti-PPAP2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL |
Rabbit anti-GLB1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GLB1 |
Rabbit Polyclonal Anti-ARSA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARSA antibody: synthetic peptide directed towards the N terminal of human ARSA. Synthetic peptide located within the following region: DLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVR |
Rabbit Polyclonal Anti-ARSA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARSA antibody: synthetic peptide directed towards the middle region of human ARSA. Synthetic peptide located within the following region: KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH |
Rabbit polyclonal antibody to beta-glucosidase (glucosidase, beta; acid (includes glucosylceramidase))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 65 and 384 of GBA (Uniprot ID#P04062) |
ARSA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ARSA |
Rabbit Polyclonal Anti-ASAH1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASAH1 antibody: synthetic peptide directed towards the N terminal of human ASAH1. Synthetic peptide located within the following region: MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWY |
SPHK1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SPHK1 |
Rabbit Polyclonal Anti-ASAH1 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASAH1 antibody: synthetic peptide directed towards the middle region of human ASAH1. Synthetic peptide located within the following region: QSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTP |
Rabbit Polyclonal Anti-PPAP2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLL |
Goat Polyclonal Antibody against Arylsulfatase A
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YDLSKDPGENYN, from the internal region of the protein sequence according to NP_000478.2. |
Rabbit polyclonal anti-Sphingosine Kinase 2 (SPK2) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acid 603 of rat Sphingosine Kinase 2 |
Anti-PPAP2C Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-269 amino acids of human phosphatidic acid phosphatase type 2C |
Rabbit polyclonal SPHK1 Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This SPHK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-315 amino acids from the Central region of human SPHK1. |
Rabbit Polyclonal Anti-GLA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GLA Antibody: synthetic peptide directed towards the N terminal of human GLA. Synthetic peptide located within the following region: PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF |
Rabbit polyclonal anti-GLB1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLB1. |
Rabbit Polyclonal SPT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SPT1 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human SPT1. The immunogen is located within amino acids 380 - 430 of SPT1. |
Rabbit Polyclonal anti-PPAP2A antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV |
Rabbit Polyclonal Anti-GALC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GALC Antibody: synthetic peptide directed towards the middle region of human GALC. Synthetic peptide located within the following region: LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL |
Rabbit Polyclonal Anti-CERK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CERK antibody is: synthetic peptide directed towards the C-terminal region of Human CERK. Synthetic peptide located within the following region: FVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSS |
Rabbit Polyclonal Anti-DEGS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DEGS1 antibody: synthetic peptide directed towards the N terminal of human DEGS1. Synthetic peptide located within the following region: GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMV |
Rabbit Polyclonal Anti-SGMS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGMS2 antibody: synthetic peptide directed towards the N terminal of human SGMS2. Synthetic peptide located within the following region: KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY |
Rabbit Polyclonal Anti-SPTLC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPTLC1 antibody: synthetic peptide directed towards the middle region of human SPTLC1. Synthetic peptide located within the following region: ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI |
Goat Anti-SPHK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DVDLESEKYRRLGE, from the internal region of the protein sequence according to NP_068807.2; NP_892010.1. |
Rabbit Polyclonal Sphingosine Kinase 1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The epitope recognized by this antibody maps to a region between residue 334-384 of human sphingosine kinase 1 using the numbering given in entry NP_001136073.1 |
Rabbit polyclonal SPHK2(Thr614) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SPHK2 around the phosphorylation site of threonine 614 (P-L-TP-P-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-Sphingosine Kinase 1 (SPK1) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acid 180 of mouse Sphingosine Kinase 1 |
Rabbit Polyclonal Anti-SGPL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGPL1 antibody is: synthetic peptide directed towards the C-terminal region of Human SGPL1. Synthetic peptide located within the following region: IHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTT |
Rabbit Polyclonal Anti-SGMS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGMS2 antibody: synthetic peptide directed towards the N terminal of human SGMS2. Synthetic peptide located within the following region: KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY |
Rabbit Polyclonal Anti-SPTLC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPTLC1 antibody: synthetic peptide directed towards the middle region of human SPTLC1. Synthetic peptide located within the following region: DLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKY |
Rabbit Polyclonal Anti-SMPD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMPD1 antibody: synthetic peptide directed towards the middle region of human SMPD1. Synthetic peptide located within the following region: INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV |
Rabbit Polyclonal Anti-SGPP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGPP1 antibody: synthetic peptide directed towards the middle region of human SGPP1. Synthetic peptide located within the following region: THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT |
Rabbit Polyclonal Anti-SPHK1 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SPHK / SPHK1 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human SPHK1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Gorilla, Dog, Bat, Elephant, Panda, Rabbit (93%); Horse (87%); Mouse, Rat, Bovine (80%). |
Rabbit Polyclonal Anti-CERK Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Ceramide Kinase / CERK antibody was raised against synthetic 14 amino acid peptide from internal region of human CERK. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Panda (100%); Gorilla, Dog, Elephant, Horse (93%); Mouse, Rat, Hamster (86%). |
Rabbit Polyclonal Anti-CERK Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Ceramide Kinase / CERK antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human CERK. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey, Marmoset (90%); Dog, Panda (85%); Bovine, Elephant, Rabbit (80%). |
Rabbit anti SPHK1 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti SPHK2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A recombinant protein encoding the full length of 618 aa human SPHK2. |
Germany
Japan
United Kingdom
China
