EGF mouse monoclonal antibody, clone S-21, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
EGF mouse monoclonal antibody, clone S-21, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-Human EGF Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived recombinant Human EGF |
EGF mouse monoclonal antibody, clone KT2, Aff - Purified
Applications | ELISA |
Reactivities | Human |
EGF mouse monoclonal antibody, clone S-147, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-EGF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY |
EGF rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human EGF (hEGF). |
EGF rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human EGF (hEGF). |
Rabbit Polyclonal Anti-EGF Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF |
EGF mouse monoclonal antibody, clone S-146, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
EGF rabbit polyclonal antibody, Serum
Applications | ELISA, IHC, WB |
Immunogen | Recombinant EGF precursor from Suberites domuncula. |
EGF rabbit polyclonal antibody, Serum
Applications | ELISA, IHC, WB |
Immunogen | Recombinant EGF precursor from Suberites domuncula. |
EGF rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
EGF rabbit polyclonal antibody, Biotin
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (>98%) recombinant hEGF (human EGF). |
EGF rabbit polyclonal antibody, Biotin
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (>98%) recombinant hEGF (human EGF). |
Biotinylated Anti-Human EGF Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived recombinant Human EGF |
EGF (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 689-720 amino acids from the Central region of human EGF |
EGF mouse monoclonal antibody, clone S-120, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
EGF mouse monoclonal antibody, clone S-145, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
EGF mouse monoclonal antibody, clone S-146, Biotin
Applications | ELISA |
Reactivities | Human |
Conjugation | Biotin |
EGF mouse monoclonal antibody, clone S-146, HRP
Applications | ELISA |
Reactivities | Human |
Conjugation | HRP |
EGF mouse monoclonal antibody, clone S-177, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
EGF mouse monoclonal antibody, clone KT2, Aff - Purified
Applications | ELISA |
Reactivities | Human |
EGF mouse monoclonal antibody, clone KT2, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Rabbit Polyclonal Anti-EGF Antibody, Purified
Applications | E(capture) |
Reactivities | Human |
Immunogen | Purified recombinant human EGF |
EGF mouse monoclonal antibody, clone S-134, Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Pro-EGF Goat Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Internal region (near the N terminus) (SRQERVCNIEKNVS) |
Carrier-free (BSA/glycerol-free) EGF mouse monoclonal antibody,clone OTI2F9
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGF mouse monoclonal antibody,clone OTI8E2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-EGF Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor |
Anti-EGF Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor |
EGF mouse monoclonal antibody,clone OTI2F9
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
EGF mouse monoclonal antibody,clone OTI2F9, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
EGF mouse monoclonal antibody,clone OTI2F9, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
EGF mouse monoclonal antibody,clone OTI2F9
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
EGF mouse monoclonal antibody,clone OTI8E2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
EGF mouse monoclonal antibody,clone OTI8E2, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
EGF mouse monoclonal antibody,clone OTI8E2, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
EGF mouse monoclonal antibody,clone OTI8E2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".