Antibodies

View as table Download

Rabbit polyclonal Kv7.3/KCNQ3 (Thr246) antibody(Phospho-specific)

Applications IHC
Reactivities Human: Thr246, Mouse: Thr247, Rat: Thr247
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Kv7.3/KCNQ3 around the phosphorylation site of threonine 246 (G-G-TP-W-K).
Modifications Phospho-specific

KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Pig, Horse
Conjugation Unconjugated
Immunogen KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Horse, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%).

KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Guinea pig, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen KCNJ6 / GIRK2 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Panda, Bat (94%); Opossum (89%).

KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Orang-Utan, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen KCNJ6 / GIRK2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig (100%); Opossum (93%); Turkey, Platypus, Lizard (87%).

Mouse Monoclonal Anti-Kv1.2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Xenopus, Zebrafish
Conjugation Unconjugated

Mouse Monoclonal Anti-Kv1.6 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-K2P3.1 (TASK-1)

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide (C)EDEKRDAEHRALLTRNGQ, corresponding to amino acid residues 252-269 of human K2P3.1 (TASK-1). Intracellular, C-terminal part.

Rabbit Polyclonal Anti-KCa2.3 (C-term)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KQIGSLESKLEHLTAS, corresponding to amino acid residues 659-674 of human KCa2.3. Intracellular, C-terminal part.

Rabbit Polyclonal Anti-K2P6.1

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide (C)ESHQQLSASSHTDYASIPR, corresponding to residues 295-313 of human K2P6.1 (TWIK-2).Intracellular, C-terminus.

Rabbit Polyclonal Anti-KV4.1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KRRAIRLANSTAS, corresponding to amino acid residues 538-550 of human Kv4.1. Intracellular, C-terminal domain.

Rabbit Polyclonal Anti-KV4.3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)NEALELTGTPEEEHMGK, corresponding to amino acid residues 451-468 of human Kv4.3. Intracellular, C-terminus.

Rabbit Polyclonal Anti-KV1.8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KDPETLLPTNDIHCR, corresponding to amino acid residues 187- 200 of human KV1.8. Intracellular, N-terminus.

Rabbit Polyclonal Anti-KV7.1 (KCNQ1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)TYEQLTVPRRGPDEGS, corresponding to amino acid residues 661-676 of human Kv7.1. Intracellular, C-terminus.

Rabbit Polyclonal Anti-KV1.3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human Kv1.3. Intracellular, C-terminus.

Rabbit Polyclonal Kv1 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopu
Conjugation Unconjugated
Immunogen Synthetic peptide made to rat Kv1.2 (within residues 50-100), which is identical in all members of the Kv1 family.

Rabbit Polyclonal Potassium Channel Kv3.1 Antibody

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of rat Kv3.1 (within residues 350-400). [Swiss-Prot# P25122]

Rabbit Polyclonal Anti-KCND3 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-KCND3 antibody: synthetic peptide directed towards the middle region of human KCND3. Synthetic peptide located within the following region: KARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIE

Rabbit Polyclonal Anti-Kcnj16 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Kcnj16 antibody is: synthetic peptide directed towards the C-terminal region of Rat Kcnj16. Synthetic peptide located within the following region: VTFIYTGDSTGTSHQSRSSYVPREILWGHRFHDVLEVKRKYYKVNCLQFE

Rabbit Polyclonal Anti-Kcng4 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Kcng4 antibody is: synthetic peptide directed towards the middle region of RAT Kcng4. Synthetic peptide located within the following region: SDESPEAGERPSGSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTLGL

Carrier-free (BSA/glycerol-free) KCNJ3 mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KCNJ3 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KCNJ3 mouse monoclonal antibody, clone OTI1D3 (formerly 1D3)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KCNJ3 mouse monoclonal antibody, clone OTI3E11 (formerly 3E11)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KCNJ3 mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KCNJ3 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KCNJ3 mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KCNJ3 mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-KCNA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 460-472 amino acids of Human potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)

Anti-KCNA1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 460-472 amino acids of Human potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)

Anti-KCNH2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 886-899 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 2

Anti-KCNH8 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1095-1107 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 8

Anti-KCNH8 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1095-1107 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 8

Anti-KCNC2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 16-30 amino acids of Human potassium voltage-gated channel, Shaw-related subfamily, member 2

Anti-KCNC2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 16-30 amino acids of Human potassium voltage-gated channel, Shaw-related subfamily, member 2

Anti-KCNH3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 95-144 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 3

Anti-KCNC1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 499-511 amino acids of human potassium voltage-gated channel, Shaw-related subfamily, member 1

Anti-KCNC1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 499-511 amino acids of human potassium voltage-gated channel, Shaw-related subfamily, member 1

Anti-KCNA5 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 517-613 amino acids of human potassium voltage-gated channel, shaker-related subfamily, member 5

Anti-KCNA5 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 517-613 amino acids of human potassium voltage-gated channel, shaker-related subfamily, member 5

Rabbit Polyclonal Anti-KCNJ11 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KCNJ11

Rabbit Polyclonal Anti-KCNK1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KCNK1

Rabbit Polyclonal Anti-KCNK13 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KCNK13

Rabbit Polyclonal Anti-KCNQ1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KCNQ1

Rabbit Polyclonal Anti-KCNJ6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNJ6

Rabbit Polyclonal Anti-KCNJ9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNJ9

Rabbit Polyclonal Anti-KCND1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCND1

Rabbit Polyclonal Anti-KCNG1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNG1

Rabbit Polyclonal Anti-KCNG2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNG2

Rabbit Polyclonal Anti-KCNK9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNK9

Rabbit Polyclonal Anti-KCNK3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNK3