Germany
Japan
United Kingdom
China
Cathepsin D (CTSD) (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 383~412 amino acids from the C-terminal region of human CTSD |
Antibodies
View as table Download
Cathepsin Z (CTSZ) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 29-57 amino acids from the N-terminal region of human CTSZ |
Goat Polyclonal Antibody against CTSF
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CGVNTMASSAVVD, from the C Terminus of the protein sequence according to NP_003784.2. |
Goat Anti-CLN2 / TPP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TPSVIRKRYNLTSQD, from the internal region of the protein sequence according to NP_000382.3. |
Rabbit Polyclonal antibody to Cathepsin D (cathepsin D)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 72 and 292 of Cathepsin D (Uniprot ID#P07339) |
Rabbit polyclonal Dipeptidyl-peptidase 1 (heavy chain, Cleaved-Arg394) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Dipeptidyl-peptidase 1. |
Rabbit polyclonal anti-Cathepsin L antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 223 of human Cathepsin L |
Mouse monoclonal CTSD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Napsin A Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-LGMN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LGMN antibody is: synthetic peptide directed towards the middle region of Human LGMN. Synthetic peptide located within the following region: KMVFYIEACESGSMMNHLPDNINVYATTAANPRESSYACYYDEKRSTYLG |
Rabbit Polyclonal Anti-LGMN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LGMN antibody is: synthetic peptide directed towards the middle region of Human LGMN. Synthetic peptide located within the following region: ESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTN |
Rabbit Polyclonal Anti-CTSC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTSC antibody: synthetic peptide directed towards the middle region of human CTSC. Synthetic peptide located within the following region: WTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLTAEIQQKILHLPTS |
Rabbit Polyclonal Anti-CTSK Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTSK antibody: synthetic peptide directed towards the middle region of human CTSK. Synthetic peptide located within the following region: SPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMY |
Rabbit anti Cathepsin D Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NAPSA mouse monoclonal antibody,clone OTI4G9
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NAPSA mouse monoclonal antibody, clone OTI8A5
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NAPSA mouse monoclonal antibody, clone OTI3G2
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-CTSZ Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 62-303 amino acids of Human Cathepsin Z |
Anti-CTSG Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 21-255 amino acids of human cathepsin G |
Anti-CTSH Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 116-335 amino acids of human cathepsin H |
Anti-CTSE Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 57-367 amino acids of Human Cathepsin E |
Anti-CTSB Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 80-333 amino acids of human cathepsin B |
Anti-AGA Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 206-346 amino acids of human aspartylglucosaminidase |
Rabbit Polyclonal Napsin A Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CTSC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CTSC |
Rabbit Polyclonal Anti-CTSK Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CTSK |
CTSE Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CTSE Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
AGA Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Families
- Protease
Pathways
- Lysosome